KEGG   Zunongwangia profunda: ZPR_2751Help
Entry
ZPR_2751          CDS       T01216                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zpr  Zunongwangia profunda
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZPR_2751
   01230 Biosynthesis of amino acids
    ZPR_2751
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_2751
   00030 Pentose phosphate pathway
    ZPR_2751
   00051 Fructose and mannose metabolism
    ZPR_2751
   00052 Galactose metabolism
    ZPR_2751
  Energy metabolism
   00680 Methane metabolism
    ZPR_2751
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ZPR_2751
Enzymes [BR:zpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ZPR_2751
Protein phosphatases and associated proteins [BR:zpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ZPR_2751
Messenger RNA biogenesis [BR:zpr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ZPR_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2954918..2955904)
Genome map
AA seq 328 aa AA seqDB search
MSKKIKRIGVITSGGDAPGMNAAIRAVVRACSYYHISCYGFYNGYNGLINGNFEELDARS
VRNIINLGGTFLKSARSKEFRTKEGREKAYKVLKKEQVDGLILIGGDGTFTGGQIFSREY
DIPVIGVPGTIDNDIYGTSHTIGYDTALNTVVEAIDKIRDTASSHDRLFFIEVMGRDAGF
IALNTGIGAGAEEILIPEENLGLDRLLDSLEKSRRSGKNSSIVIVSEGDKIGKNVFQLAD
YVKENLPYYDAKVTVLGHIQRGGIPSCFDRVLASRMSVKAVELLLDGQKNVMVGLKDDDI
ITCPLDDVIHEKPKINKDLLRISEILST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaaattaaacgaattggagtgattacttccgggggagatgccccgggtatg
aatgctgctattcgagctgttgttagggcgtgttcctattatcacataagctgttatgga
ttttataatggatataacggacttataaacggaaattttgaagaacttgatgctcgtagt
gtacgaaatataattaatctgggaggtacttttcttaagagtgcacgctctaaagaattt
agaactaaagaaggacgggagaaggcttataaggtgctaaaaaaagagcaagtagacggc
ctgatccttattggaggtgatggaacctttacaggggggcagatttttagtcgcgagtat
gatattcctgttattggagttcccggaactatagataatgatatctacggaacttcgcat
accattggttacgataccgctctaaatactgtagtagaagctatcgataaaattagggat
acagcgagctctcatgatcgtttattctttatcgaagttatgggccgcgacgcaggtttt
atcgcattaaatactggtattggtgcaggagcggaagaaattttaattcctgaagaaaac
ttaggtttagatcgattgttagactctttggaaaagagtagaagatcgggaaaaaattct
agtattgtaatagtttctgaaggagataaaattggaaaaaacgtatttcaactagcagat
tatgtaaaagaaaacctgccttattatgatgcaaaagtaacggttttaggacatattcag
cgtggaggaataccttcttgttttgaccgtgttctggcaagcagaatgtctgtaaaagca
gtagagcttttattggatgggcagaaaaacgtaatggtgggcttaaaagatgatgatatc
attacctgtcctttagatgatgtaattcacgaaaaaccaaaaatcaataaagatttactt
agaatctcagaaattctttctacttaa

DBGET integrated database retrieval system