KEGG   Zunongwangia profunda: ZPR_2751Help
Entry
ZPR_2751          CDS       T01216                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00010  Glycolysis / Gluconeogenesis
zpr00030  Pentose phosphate pathway
zpr00051  Fructose and mannose metabolism
zpr00052  Galactose metabolism
zpr00680  Methane metabolism
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
zpr01120  Microbial metabolism in diverse environments
zpr01130  Biosynthesis of antibiotics
zpr01200  Carbon metabolism
zpr01230  Biosynthesis of amino acids
zpr03018  RNA degradation
Module
zpr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zpr_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_2751
   00030 Pentose phosphate pathway
    ZPR_2751
   00051 Fructose and mannose metabolism
    ZPR_2751
   00052 Galactose metabolism
    ZPR_2751
  Energy metabolism
   00680 Methane metabolism
    ZPR_2751
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ZPR_2751
Enzymes [BR:zpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ZPR_2751
Protein phosphatases and associated proteins [BR:zpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ZPR_2751
Messenger RNA biogenesis [BR:zpr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ZPR_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADF53073
UniProt: D5BFW0
Position
complement(2954918..2955904)
Genome map
AA seq 328 aa AA seqDB search
MSKKIKRIGVITSGGDAPGMNAAIRAVVRACSYYHISCYGFYNGYNGLINGNFEELDARS
VRNIINLGGTFLKSARSKEFRTKEGREKAYKVLKKEQVDGLILIGGDGTFTGGQIFSREY
DIPVIGVPGTIDNDIYGTSHTIGYDTALNTVVEAIDKIRDTASSHDRLFFIEVMGRDAGF
IALNTGIGAGAEEILIPEENLGLDRLLDSLEKSRRSGKNSSIVIVSEGDKIGKNVFQLAD
YVKENLPYYDAKVTVLGHIQRGGIPSCFDRVLASRMSVKAVELLLDGQKNVMVGLKDDDI
ITCPLDDVIHEKPKINKDLLRISEILST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaaattaaacgaattggagtgattacttccgggggagatgccccgggtatg
aatgctgctattcgagctgttgttagggcgtgttcctattatcacataagctgttatgga
ttttataatggatataacggacttataaacggaaattttgaagaacttgatgctcgtagt
gtacgaaatataattaatctgggaggtacttttcttaagagtgcacgctctaaagaattt
agaactaaagaaggacgggagaaggcttataaggtgctaaaaaaagagcaagtagacggc
ctgatccttattggaggtgatggaacctttacaggggggcagatttttagtcgcgagtat
gatattcctgttattggagttcccggaactatagataatgatatctacggaacttcgcat
accattggttacgataccgctctaaatactgtagtagaagctatcgataaaattagggat
acagcgagctctcatgatcgtttattctttatcgaagttatgggccgcgacgcaggtttt
atcgcattaaatactggtattggtgcaggagcggaagaaattttaattcctgaagaaaac
ttaggtttagatcgattgttagactctttggaaaagagtagaagatcgggaaaaaattct
agtattgtaatagtttctgaaggagataaaattggaaaaaacgtatttcaactagcagat
tatgtaaaagaaaacctgccttattatgatgcaaaagtaacggttttaggacatattcag
cgtggaggaataccttcttgttttgaccgtgttctggcaagcagaatgtctgtaaaagca
gtagagcttttattggatgggcagaaaaacgtaatggtgggcttaaaagatgatgatatc
attacctgtcctttagatgatgtaattcacgaaaaaccaaaaatcaataaagatttactt
agaatctcagaaattctttctacttaa

DBGET integrated database retrieval system