KEGG   Zunongwangia profunda: ZPR_2971Help
Entry
ZPR_2971          CDS       T01216                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
zpr  Zunongwangia profunda
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ZPR_2971
Enzymes [BR:zpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ZPR_2971
Exosome [BR:zpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZPR_2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3219764..3221569
Genome map
AA seq 601 aa AA seqDB search
MMEENKLSYPIAPSDGMGAIPENDKTTFRVWAPNADKVSVTGDFNDWNPNDLPLEPEENG
YWAATTTKAKKGDQYKYHIENGDISVYKNDPYAFEVTNSDGNSIIRDLNFDWEEDNFQLP
PWNSLVIYELHVGTFNRKNPDAVGTFQDVIEKLDYLKSLGINCIELLPVAEFAGGISWGY
NPAHPFAIEQDYGGPEGLFQLIKTAHQKGIGVIMDVVYNHLGPSDVDLWQFDGWQENDKG
GIYFYNDHRSDTPWGDTRPDYGRPEVRQYFRDNALMWIEKYHCDGLRMDATSYIRYEGGG
LGFDTEILEGIIMMRDINAEIRHKYPNTITIAEDLKADNIITAPTENGGIGYGTQWDMKF
VHPVREVLTALNDDERDLQKIVDAIVYKYNDDVFNRVIYTESHDEVANGKARVPEEIQPG
DAESSFAKKRSILGLVLVMTSPGIPMIFQGQEFLEDGYFKDTEELNWDKLNRLEGIDQLS
ADLIKLRTGETPGAEGLKGQHTEIIHFNQENKILAYKRTMDGAQPALIILNFGNNDFEDY
GIGIEADKNWKIKFNSTWKGYDKDFSELPVEDIQKVHEESDQKEWTGKVNIPAYGALIYA
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagaaaataagctaagttatcctatagctccctctgatgggatgggtgctata
ccagaaaatgataaaactacatttagggtttgggctcccaatgccgataaagtaagtgtt
acaggcgattttaatgactggaacccaaacgatttgcctctagagccagaagaaaacggc
tattgggcagccacgaccaccaaagcaaaaaaaggcgatcaatataaatatcatatcgaa
aacggtgatatttcagtgtacaaaaacgatccctatgcttttgaagtcaccaatagcgac
ggaaattcaataattcgggatcttaattttgattgggaagaagataattttcaattaccc
ccgtggaattcgctggtgatttacgaacttcatgtgggtacttttaaccgtaaaaatcca
gatgctgtaggtacttttcaggatgttatcgaaaaactggattacctgaaatctctcggt
attaattgtatcgaattactgccggtagccgaatttgccggtggaatttcctggggttat
aatccagcacatccttttgctatagaacaggattatggcggacctgaaggtctttttcaa
ttaataaagacagcacatcaaaaaggaattggagtcattatggatgttgtctacaatcat
ttagggccatctgatgtcgatctatggcaatttgacggttggcaggagaatgataaagga
gggatttatttttataatgatcaccgcagcgatactccctggggtgatacacgaccagat
tatggccgccctgaagttcggcagtattttagggataatgctttaatgtggatcgaaaaa
tatcattgcgatggtcttaggatggatgccacatcctacattcgatatgaaggtggcgga
ttaggttttgataccgaaattcttgagggcatcatcatgatgcgagacataaatgctgaa
attcgacataaatatcccaataccataaccattgcggaagatcttaaagctgacaatatc
atcacagctcctacagaaaatggggggattggatatggaacacagtgggatatgaaattt
gtacatccggtaagagaagtattaacggcattaaacgatgatgaacgcgacctgcaaaaa
attgttgatgccatagtttacaagtataatgacgatgtatttaatcgggtaatctacacc
gaatcccatgacgaagttgccaacggaaaagccagggttccggaagaaattcaacccggc
gatgccgaaagtagttttgctaaaaaacgatccatcttaggtttagtactggtgatgact
tccccaggaattcccatgatttttcagggacaggaatttttagaggacggctattttaaa
gatacggaagaactcaactgggacaaattaaaccgacttgaaggaatcgatcaacttagt
gccgatcttattaaactgagaaccggagaaaccccaggcgcggaaggccttaaaggacaa
catactgaaatcatccattttaaccaggaaaataaaattttggcttataaacgtacaatg
gacggggcacagcctgccctgataattcttaacttcggaaataatgattttgaagactac
ggaattggtattgaagcagataaaaactggaaaataaaatttaacagtacatggaaaggt
tacgataaagatttctctgaattaccggtagaagacatccaaaaagtacatgaagaatca
gaccaaaaagaatggacaggtaaagtgaatattcctgcttatggagcactaatttatgcg
ttgtaa

DBGET integrated database retrieval system