KEGG   Zunongwangia profunda: ZPR_3039Help
Entry
ZPR_3039          CDS       T01216                                 

Definition
endo-beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
zpr  Zunongwangia profunda
Brite
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     ZPR_3039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3294369..3295493
Genome map
AA seq 374 aa AA seqDB search
MKHKKQLHYLLILLLFGIISCKDQQKTKDITAKEDPKKEKGLKDYFAEDFPMGVAVSPAS
LEGKSKELILAEYNSLTPENVMKMGVIHPKKDEFNWAPADKIVAFAQENGLKVRGHALVW
HQQTGDWIFKDDKGNDVSREVLLDRMKAHIDSVVGRYKGKIYAWDVVNEAIDDNPQNFLR
NSKWLEIIGDDFLTKAFEFAHAADPNAKLFYNDYNIIIPEKRDRVLKLIDKLKAEGAPIN
GIGIQGHWSVFNPSEEELQQALKMYTETGLDVQITELDVSLYKWEKEQRERRPGDSDEFT
EERKLAQIEAYQKFFKVFREYRDKLTGITFWNIADRYSWLDHYPVEGRKNYPLLFDENYQ
RKQVYDSVIKFSKK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataaaaaacaactgcactatcttttgatcttattgctttttggcattatttcg
tgtaaggatcagcaaaaaacaaaggatattactgctaaagaagacccaaagaaagaaaaa
ggactcaaagattattttgccgaagatttccctatgggcgttgcggtttcaccggcttca
cttgaaggaaaatcaaaagaattaattttagcggaatataacagcttaactcctgaaaac
gtaatgaaaatgggggtaattcatccaaaaaaagatgaatttaactgggcaccagccgat
aaaatagtagcatttgctcaggaaaacgggcttaaagtacgcggtcacgccctggtttgg
catcaacaaaccggtgactggatttttaaagatgacaagggcaatgatgttagcagggag
gtcttactagaccgaatgaaagctcatatcgactcggttgttggtcgatacaaaggaaaa
atatatgcctgggatgtggtgaatgaagcaattgacgataatccgcagaactttctaaga
aattcaaagtggcttgaaatcatcggagatgattttcttaccaaagcatttgaatttgct
cacgcagccgatcccaatgccaagttattttataatgattacaatattattattccggaa
aaaagagaccgcgttttaaaactaatcgataaattgaaagcggaaggagcgccgataaac
ggaatcggaatacagggacactggtctgtttttaatccaagtgaagaggagttacaacag
gctttaaaaatgtatacggaaaccggtctggatgtgcagattaccgaactggatgtgtct
ctgtataaatgggaaaaagaacaacgggaacgacgcccgggcgattcagatgagtttacc
gaagaacgtaaacttgcccaaatagaagcctatcaaaagttctttaaagtatttagggaa
tatcgagataagcttaccgggatcactttttggaatattgcagatcgctattcctggttg
gatcactatcctgtagaaggacgaaaaaactatccattattatttgatgaaaattaccag
agaaaacaagtttatgattcagttatcaaattcagtaaaaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system