KEGG   Zunongwangia profunda: ZPR_3341Help
Entry
ZPR_3341          CDS       T01216                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
zpr  Zunongwangia profunda
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:zpr00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3609883..3612264
Genome map
AA seq 793 aa AA seqDB search
MNLSTLKPNTSDITSETLEHINGYWRAANYLSVGQIYLRDNPLLKRPLKKEDIKLMRLGH
WGTTPGQNFIYVHLNRIIKKYDLDMVYVSGPGHGGPALVGNTYLEGSYTEIYPEITQDEN
GLKKLFKQFSFPGGIPSHVSPECPGSFHEGGELGYSLAHSFGAVFDNPNLIAACVVGDGE
AETGALAASWHSNKFLNPETDGVVLPILHLNGYKIANPSLLARIPHEELIKLMEGYGWKP
YVVEGDEPMQMHRDMSFALDNAMADIKKIKNYTTQEDSQVPRWPMIILKSPKGWTGPKFI
DGKPVENHFRSHQVPLSDPIDNDEDFKQLEKWLQSYQIGELFDKNGTLKKVYKELAPQGS
RRMGMNPNTNGGLLLKDLLLPDVQDFALPVKSHGDNGPGDTRSVGAFLKEVINLNSKQQN
FRLFGPDEILSNRLNEVFDATNRQWNAQTDPNDEFLAPQGRAMEILSEHLCEGWLEGYLL
TGRHGLFTSYEAFIHIIDSMFNQHAKWLKVTAELPWRRQLASLNILLASHVWRQDHNGFT
HQDPGFIDHVVNKKASIIRVYLPPDANCLLLTMKHCLKSKHYVNVMVAGKHPSPQWLPYD
QAILHCSKGIGVWDWASNDQEDQTDIVMACAGDVPTLETLAAVSILRKELPELRIRVINI
VDLMKLQSETAHPHGLSDSDFDALFTKDKPVIFAFHAYPWLIHRLTYKRTNHHNFHVHGY
QEEGTITTPFDMTVLNKLDRYHLVQDVLKHIPRSESKNDYLQEKMKDMLIKHRNYIEEHG
VDMPDVKDWKWDI
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttcaacgcttaaaccaaatacttccgacatcacatcagaaacgctagagcat
ataaatggctactggcgtgcagccaattatctttccgttggacaaatatatctacgcgac
aatccactattaaagcgacctttaaaaaaagaggacattaaattaatgcgattgggacac
tggggaactactcctggtcagaatttcatttatgtccacctcaatcgtataataaaaaaa
tatgatttagatatggtttacgtctccggtcctggtcacggagggcctgctttagttggg
aacacttatctggaaggaagttatacagaaatatatcctgaaatcactcaggatgaaaat
ggattgaaaaaattatttaagcagttttcttttccaggggggattccaagtcatgtttct
ccagaatgccctggttcgttccacgaaggaggcgaattaggttactcccttgcacatagt
ttcggtgctgtattcgacaatccgaacctgatagctgcatgtgtggtaggagatggtgaa
gcggaaaccggtgctttagcagcctcctggcattctaacaaatttttaaacccggagact
gatggtgtagtactacccattctacatttaaatggttataaaatagccaatcctagtctt
ttagccagaatacctcatgaggaacttataaagctcatggagggatacggttggaaacct
tatgtagtggaaggagatgagccgatgcagatgcatagagatatgtctttcgcactggac
aatgcaatggctgatattaaaaaaattaagaattataccacccaagaagattcgcaagtt
ccacggtggccaatgatcatattaaaatctcctaaaggatggacagggccgaaattcatt
gatggaaaacctgtagaaaatcattttaggtcacatcaggtaccactttcggatcctatt
gataacgatgaggattttaaacaactagaaaagtggttacaaagttatcagatcggagaa
ctttttgataaaaacggaaccctaaaaaaagtgtataaggaacttgctcctcaaggtagc
cggcgcatgggaatgaatcctaataccaatggaggtttacttctcaaagatcttcttctt
cctgatgtgcaagacttcgccttacctgtaaaatctcacggagataacggacctggggat
actagaagtgtaggagcttttttaaaagaggtcattaatttaaattcaaagcagcagaat
ttcagactctttggtccggatgaaattctgtcaaaccgactaaatgaagtgtttgatgct
actaataggcaatggaatgcgcaaacagatcctaacgatgaatttttggctcctcaggga
cgagctatggaaatattgagtgagcatttatgtgagggttggctggaaggatatttactt
accggaaggcatggtttattcacgtcatacgaggcctttatacatattatcgactcgatg
tttaatcaacatgcaaagtggttaaaggttactgcagagctcccctggagacgacaactt
gcatcacttaatattttacttgcttctcatgtctggcggcaggatcataatggattcact
catcaggatccaggatttatagaccatgttgtcaacaaaaaagcctcaattattagggta
tacctcccgccagatgctaactgtctactattaactatgaaacattgtttgaagagtaag
cattatgtcaatgttatggtagccggtaaacatccttcaccccaatggcttccttatgac
caggctattttacattgcagtaaaggcattggtgtctgggattgggccagtaacgatcaa
gaggatcaaaccgatatcgttatggcttgtgccggtgatgtacctactttggaaactcta
gctgccgtatccatccttcgtaaagaacttccggagttacgcatccgggtaattaatatc
gtagatcttatgaagttacagtcggaaaccgcccatccccatgggctatccgactcggat
tttgatgcattattcaccaaagacaaaccggtcatatttgcatttcatgcgtatccctgg
ctgatccaccgactaacctacaaacgtaccaatcatcataattttcatgtccatggatat
caggaagaaggaacaatcaccacaccttttgatatgacagtactcaataaactagatcga
tatcatctggttcaagatgtgttaaaacatattcctaggtcagaatccaaaaatgactac
ctgcaagaaaaaatgaaagatatgttaattaaacatcggaattacattgaagagcatggc
gttgatatgcctgatgtcaaggactggaaatgggatatatga

DBGET integrated database retrieval system