KEGG   Zunongwangia profunda: ZPR_3404Help
Entry
ZPR_3404          CDS       T01216                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zpr  Zunongwangia profunda
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZPR_3404
   01230 Biosynthesis of amino acids
    ZPR_3404
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_3404
   00030 Pentose phosphate pathway
    ZPR_3404
   00051 Fructose and mannose metabolism
    ZPR_3404
   00052 Galactose metabolism
    ZPR_3404
  Energy metabolism
   00680 Methane metabolism
    ZPR_3404
Enzymes [BR:zpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ZPR_3404
Protein phosphatases and associated proteins [BR:zpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ZPR_3404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3665153..3666127
Genome map
AA seq 324 aa AA seqDB search
MNTNKIKHIGVFTSGGDSPGMNSALYAIAKTAEATGIKVSGFRKGYEGLIDGDLVQLKSH
ELQKLTQKGGTILKTARSKRFLELEGRKKALQTLNVNKIDALIAIGGDGTFKGLLAFSEI
CDIPFIGIPGTIDNDISGTDYTLGFDSAVNTAIENIDKIRDTAESHNRVFIVEVMGRDSG
YIGIHSGLMVGADAILIPESGTDFINLLGKVKNYDSEDAFLIVVSEGDEIGAELVSSKIK
EVNPNVDLRITKLGHIQRGGNPSALDRMLGIRLGVEAVKSLLQSKKNVMVGILNNQLHLT
PFNEVVKQHQVNKELHELLELFGT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatactaataaaattaaacatataggtgtatttacctctggaggtgatagtccaggg
atgaattcagccttgtacgccattgcaaaaacggctgaagcaactggtataaaagttagt
ggttttagaaaaggatatgaaggattgatagacggtgacttggttcaattaaaatcacac
gaattacaaaaactgacccaaaagggtggcactatccttaagacagcccgaagcaaacgt
tttctcgaactggaaggtcgaaaaaaagccttgcaaactctaaatgtaaacaaaatagac
gctttaattgccattggtggtgatggtacatttaaaggattacttgctttttcagagata
tgcgatatcccattcatagggattcccggaactattgataacgatatttcgggtacggat
tacacccttggttttgattccgcagttaacacagccattgaaaatattgataaaataagg
gatactgccgaatcccataaccgtgtgttcattgttgaagtaatgggaagggattcgggt
tacatcggtattcattctggattgatggttggtgcggacgccatattaattccggagagc
ggtacggactttattaaccttttgggtaaggtgaaaaattacgatagcgaggatgctttt
ctaatcgtagtttctgaaggtgacgaaattggtgccgaacttgtttcttcaaaaataaag
gaagtcaatcccaatgtcgatttacgcataacaaagcttggccacatacagcgaggtgga
aatccttctgctttggatagaatgttgggcataaggcttggggtggaagccgtaaaatcg
cttttacaaagtaaaaagaatgtaatggtcgggattttaaacaatcaattgcacttaacc
ccttttaatgaagtggtcaagcaacatcaggtcaataaagaattgcacgaacttttagaa
ctatttggaacataa

DBGET integrated database retrieval system