KEGG   Zunongwangia profunda: ZPR_3410Help
Entry
ZPR_3410          CDS       T01216                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
zpr  Zunongwangia profunda
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ZPR_3410
Enzymes [BR:zpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ZPR_3410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3670729..3672039
Genome map
AA seq 436 aa AA seqDB search
MPNEIGLSDAAAKKLNVSPNDTLYVSHLEPIESLSHVRAKIYNKKLNYKAYNNIITDIVE
GDYSNIHLSAFITACAGDRMDIDEISDLTKAMIASGKQLNWNKDIVVDKHCIGGLPGNRT
TPLVVAIVAAYGLTMPKTSSRAITSPAGTADTMEVLTNVTLSSEEIKTVVEKEGGCFVWG
GTAQLSPADDVLIKIEKALDIDSEGQLIASVLSKKAAAGSTHVVIDIPVGETAKVRSTEM
AEKLKNHMETVGTSVDLNVKVVVTDGTQPVGRGIGPTLEAIDILKVLKNEEDAPKDLTER
ALLLATELLELSGKVEKGKGLETAREILKSGQAYKKFLAICNAQGRFSKPVLAPYKTEIR
AENSGVLKRIDNRKIAKLAKLSGAPQSKSAGILLNVHLNEKIEIDQLLYTIYAESKGELN
YALEYKNNHNDIITII
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttgcctaatgaaatcggactatcagatgctgctgcgaaaaaactcaatgtttccccaaac
gatacattatatgtttcccatttagagcctattgaatccttaagccacgtcagggcaaaa
atctataacaaaaaactgaattataaggcctataacaacatcataaccgatatcgtggaa
ggcgattattccaacatccacctttcggcatttattactgcctgtgctggcgaccgaatg
gatattgatgaaatatccgacctaacgaaagcaatgattgcttccggaaagcaactgaac
tggaacaaggatatcgtggtcgacaaacattgtattggcggattgcctggcaataggaca
acaccattggtagttgccattgttgccgcgtatgggcttactatgccaaaaacatcctca
cgggcaatcacttcgccagcaggcacagcagatacaatggaagtactgaccaatgttacg
ctctcttccgaggaaataaagaccgtagtagaaaaagaaggcggatgttttgtttggggc
ggtacagcgcagttaagtcctgccgatgatgtgctcattaaaattgaaaaagccttggat
attgatagcgaaggtcagctcatcgcttcagtactctctaaaaaggcagcagctggttct
actcacgtggtcattgatattcccgtgggagaaaccgccaaggttcgcagtaccgaaatg
gcagaaaaactaaaaaatcatatggaaaccgttgggacatctgttgacttgaatgtaaaa
gttgtagttacggatggcacgcagcctgttggaaggggtatcggtccaacattagaagcc
atagatatattaaaagttttgaaaaatgaggaagatgcacctaaagacttaacagaaaga
gcattgcttttagctactgaactattagaactttctggaaaagtagaaaaaggaaaggga
ctggaaaccgcacgtgaaattctcaaatctggtcaggcttataaaaaattccttgctatt
tgtaatgcgcaaggtcgcttttcaaaacctgttttagcaccctataaaaccgaaattaga
gcagaaaactctggggttttaaagcgcatagataatagaaagatagcaaaactcgccaag
ctttccggcgcaccgcagtctaaatcggcagggattcttttgaatgtccatttaaatgaa
aaaattgaaatagaccaattattatataccatatatgctgaatccaaaggcgaactcaac
tatgctctggaatataaaaacaaccataacgacatcataactataatttaa

DBGET integrated database retrieval system