KEGG   Zunongwangia profunda: ZPR_3472Help
Entry
ZPR_3472          CDS       T01216                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
zpr  Zunongwangia profunda
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:zpr00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:zpr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3743235..3744686)
Genome map
AA seq 483 aa AA seqDB search
MWQYTFAQNDQEKRKIASWITNQDRSMLFQKEKEPVYFSNNNSRYPAIIIDPEQGMQTID
GFGFAVTGGSAEHLMKMDPRERTKILKELYGTGPEDIGISYVRLSIGSSDLNSFTFSYND
LEEGETDYELDKFSLDQDLKDVVPVMKEILAINPRIKIMGSPWSAPVWMKTNGNIRGGKL
KENCYEVYAKYFVKYIQEMDKQGIPIDAITVQNEPMNSRNTPSMSWFWFEQANFIKNHLG
PAFEKNNINTKIVIFDHNTDRPDYPLSILRDTAASRFIDGSGFHNYRGNMESMSMVHRAR
PDKNIYFTEQMVTENPQSEAIEITEPVKRLIIDGTNNWSRNIILWNLAADPLNDPHTDNG
GCSMCQGAITIDGNDVSRNIAYYAVAHASKLVSPGSRRIYSTQGDEPSIFLYQDEQRPMV
YRTGIRENSDLLPNVAFKTPDNRIVLIVANTSRDRYSFKVQYKGAYALLELDPGSVGTYS
WNL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcaatatacctttgcgcaaaacgaccaggaaaaaaggaagatcgcatcctggata
accaatcaggatcgcagtatgctttttcagaaggagaaagaacctgtttatttttcaaat
aataattcgaggtatcccgctattatcatagatccggaacaaggaatgcagactattgat
ggttttgggtttgcggttaccgggggaagtgcagaacatctaatgaaaatggatcccagg
gagcgcacgaaaattttaaaggaattatatggtaccgggccagaggatatcgggattagc
tatgtaaggcttagtattggttcatccgaccttaacagtttcaccttttcatataacgat
cttgaagaaggggaaacggattatgagctcgataagttttcccttgaccaggatttaaag
gatgttgtccctgttatgaaggaaattctggctataaatcccagaataaagatcatgggg
tctccttggtcagcgcctgtttggatgaagacaaatggcaatatccggggagggaaatta
aaggagaattgttatgaggtatacgcaaaatactttgtgaagtatatccaggaaatggat
aagcagggtattcccattgatgcgattaccgttcagaatgaacctatgaattcccgtaat
accccgagtatgtcatggttctggtttgaacaggcaaattttataaaaaatcacctcgga
ccggcatttgaaaaaaacaatatcaacactaagatagtcattttcgatcataatacagat
cgtccggattacccgttgagcatcctccgcgatactgcagcaagcagatttatcgacggt
tcaggttttcataattatcgcggtaacatggagagcatgtcaatggttcaccgcgcccgt
cctgataaaaatatttattttaccgagcagatggtaacagaaaatcctcaaagtgaagca
atcgaaatcacggagccggtaaaaagactgattatagacggaacaaataactggagtcga
aatatcatcctgtggaaccttgcggcagaccctctaaatgatcctcataccgataatgga
ggctgttccatgtgccagggagcaataaccatagacgggaacgatgtatcccggaatatc
gcctattatgcagtcgctcatgcctcaaagctcgtaagtcctggctccaggagaatttat
tctacccagggcgatgaacccagtatctttctttatcaggatgaacaacgtcctatggta
tacaggacaggaatccgggagaacagtgacctgttaccaaatgtggcttttaaaacccct
gataatagaattgtactgattgttgccaataccagccgtgacaggtattcctttaaggta
caatataaaggcgcctatgctttactggagctcgatccgggatctgtgggcacatattca
tggaacttataa

DBGET integrated database retrieval system