KEGG   Zunongwangia profunda: ZPR_3785Help
Entry
ZPR_3785          CDS       T01216                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
zpr  Zunongwangia profunda
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zpr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4088317..4088994
Genome map
AA seq 225 aa AA seqDB search
MKIDKVLNEIDEMGDAHAGSSAETPIRKDAFEVSDTDKIALIREDVERIMQTLGLDLTDD
SLKGTPQRVAKMFVNEIFSGLDPKRKPKASVFDNKYKYGEMLVEKNITVYSTCEHHLLPI
VGKAHVAYISNGTVVGLSKMNRIVDYYAKRPQVQERMTMQIVQELQQVLGTEDVACVVDA
KHLCVNSRGIRDIESSTVTSEFGGAFKQKEVRREFLDYIKLDTTF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagacaaagttttgaatgaaattgacgaaatgggtgatgcacacgccggaagt
agtgcagaaacacctataagaaaagatgcttttgaagttagtgatactgataagattgca
ctaattagagaagatgttgaacgtattatgcaaacacttggattagatcttaccgacgat
agtctaaagggcacgcctcaacgtgtagcaaaaatgtttgtaaatgagattttctctggg
ctggatccaaaaagaaaaccaaaagcatcggtttttgacaataaatacaaatatggtgag
atgcttgtagagaagaatattacagtttattctacctgcgaacatcaccttctaccaatt
gttggaaaagcacatgtagcgtatatttctaatggtaccgttgtaggtttatccaaaatg
aacagaatagtagattattacgccaaaagaccacaggtacaggaacgaatgaccatgcaa
attgtacaggaacttcagcaagtgttgggaactgaagatgtagcatgcgttgttgatgcc
aaacacctttgcgtaaatagccgtggaataagagatatagaaagcagtaccgtaaccagt
gaatttggcggtgcttttaaacaaaaagaagttcgtagagaatttttggactatattaag
ctagatactacattttaa

DBGET integrated database retrieval system