KEGG   Zunongwangia profunda: ZPR_3812Help
Entry
ZPR_3812          CDS       T01216                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
zpr  Zunongwangia profunda
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ZPR_3812
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZPR_3812
Enzymes [BR:zpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ZPR_3812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4121301..4122731)
Genome map
AA seq 476 aa AA seqDB search
MESVVGNTAVAIKNIHFDSRKVEMNDVFVAITGSVSNGHDFIEKAINQGALVIICEKLPN
DIVNGVTYVQVANSKEALAYMAANFYENPSDKLKLVGVTGTNGKTTIATLLYDLFTKAGF
KVGLLSTVKVMVGETFYDAERTTPDSLTINHYLAEMNEEGVEYCFMEVSSHGIDQHRTTG
LVFAGGIFTNLSHDHLDYHSSFAEYRDVKKRFFDELPASAFALTNVDDKNGEVMLQNTKA
KQYTYGLKNYADYKAQILENQFTGLLLKINDQEVWSRLIGSFNAYNILAIYAAAELLGLE
TLENLKFISELHSVNGRFQYFISPEEKITAIVDYAHTPDALKNVLDTINAIRTKNEELIT
VVGCGGDRDRTKRPKMGHIASALSSKVIFTSDNPRTEDADAIIEEIEKGVEPQNFNKTVS
ISNRKQAIKTACQMAQANDIILIAGKGHETYQEVNGQKHDFDDYKIVSEFLKQLKK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggaatctgtggtaggaaataccgcagttgcgatcaagaatattcattttgactcgaga
aaagttgaaatgaatgatgtttttgtagcaattacgggtagcgtttccaacggacatgat
tttatagaaaaagccattaaccagggagctttggtaattatttgcgaaaagcttccaaat
gatattgtaaatggcgttacttatgtacaggtagcaaattctaaggaagcgctggcctat
atggcagccaatttctatgaaaatccttcagataaactaaaattggttggcgttaccggt
accaatgggaaaacgactatcgccactttattgtatgatttatttaccaaagcaggtttt
aaagtaggcttactttctacagtaaaagtaatggtgggcgagacattttatgatgccgag
agaacaacaccagattcgttaaccatcaatcattatttagctgaaatgaacgaagaaggt
gtggaatattgctttatggaagtaagttctcatgggattgaccagcatcgtaccacgggc
ttagtctttgccggagggatttttaccaatcttagtcatgatcatttagactatcattcc
agttttgcggaatatcgcgatgtgaaaaagcggttctttgacgagttaccggcatcagca
tttgcgttaacaaatgtagatgataagaatggagaggttatgcttcaaaataccaaagct
aagcagtatacctacgggttaaagaattacgcggactataaagcacaaatcctcgaaaat
caatttaccggattattacttaaaatcaacgatcaggaagtttggtcaagactaataggg
agttttaatgcttataatattttggcgatttacgccgctgcggaattattaggattagaa
actttagaaaacctgaaattcatcagtgaactccattctgttaatggtcgtttccagtac
tttatctctcccgaagaaaaaattacggcaatagtggactatgcgcatacaccagatgca
ttaaaaaatgtactggacaccattaatgcaattagaaccaaaaatgaagaactgattacg
gttgtaggctgtggaggtgacagggatcgtactaaaagaccaaaaatggggcatattgct
tcggcattaagttccaaagtgatttttaccagtgataatccaagaactgaagatgcagat
gctattattgaagagatagaaaaaggggtggagcctcagaattttaataaaacagtttca
ataagcaatagaaaacaagccattaaaaccgcttgccaaatggcacaagccaatgatatc
atattaatcgcagggaaaggtcatgaaacctatcaggaagtgaacggtcaaaaacatgat
tttgacgattataagatagtgagtgaatttttaaaacagctaaaaaagtaa

DBGET integrated database retrieval system