KEGG   Zunongwangia profunda: ZPR_3923Help
Entry
ZPR_3923          CDS       T01216                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00010  Glycolysis / Gluconeogenesis
zpr00020  Citrate cycle (TCA cycle)
zpr00620  Pyruvate metabolism
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
zpr01120  Microbial metabolism in diverse environments
zpr01130  Biosynthesis of antibiotics
zpr01200  Carbon metabolism
Module
zpr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_3923
   00020 Citrate cycle (TCA cycle)
    ZPR_3923
   00620 Pyruvate metabolism
    ZPR_3923
Enzymes [BR:zpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ZPR_3923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ADF54229
UniProt: D5BM89
Position
complement(4231337..4232956)
Genome map
AA seq 539 aa AA seqDB search
MAEVINMPRLSDTMEEGVVAKWLKQKGDKVAEGDILAEIETDKATMEFESFYEGTLLHIG
IEEGETAPVDTLLAIIGEEGEDISGLLNGEGGSTEEAKEESAAEEETEDDDSASEAGEIP
EGVEIVKMPRLSDTMEEGTVASWLKKEGDKVSEGDILAEIETDKATMEFESFYEGTLLKI
GIPEGETAPVDSLLAIIGPEGTDVSNVTGDSTGKKAAPKKEEKSEAKEEKKEETTTTSSD
SSSEGGRIFASPLAKKMAEDKGIDLSKVEGSGENGRIVKKDIESYKPSEAPAPKETKKEA
ETSVAAPYVPAGEESFEEIKNSQMRKTIAKRLGESKFSAPHYYLTIEVDMENAMASRKQI
NEMPDVKVSFNDMVIKASAMALRKHPQVNSQWTGDAMKIAKHIHMGVAVAVEDGLVVPVL
KFADQMSMTQIGGNVKDLAGKARNKKLQPKEMEGSTFTVSNLGMFGITEFTSIINQPNSA
ILSVGTIVEKPVVKNGEIVVGHTMKLTLACDHRTVDGATGAAFLKDLKTYIENPVTMLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattaatatgccgcgattaagcgacaccatggaagaaggtgttgtggca
aaatggttaaaacaaaaaggcgacaaagttgctgaaggagatatccttgcggagatcgaa
accgataaggcaacgatggaatttgaatccttctatgaaggaacactattgcatataggg
attgaagaaggagaaactgctccggtagatacgcttttagcgattattggtgaagaaggt
gaagatatctctggattgttaaatggtgaaggtggttctactgaagaagctaaagaagaa
tcagcagccgaagaagaaactgaggatgatgacagcgcatctgaagctggtgaaatccca
gaaggtgtagagattgttaaaatgccgcgccttagtgacacgatggaagaaggaactgtt
gcttcctggttgaaaaaagaaggggataaagtttctgaaggtgatattcttgcggaaatc
gagaccgataaagcaacaatggaatttgaatctttctacgaaggaactttacttaaaatt
ggcattcctgagggggaaactgctcccgtagatagtcttttggcaattattggccctgag
gggactgatgtgtctaatgtgactggtgattctactggcaaaaaagctgcacctaaaaaa
gaagaaaagtctgaagctaaagaagagaaaaaggaagaaacgactacaacttcttcagat
tcgtcgtcggaaggtggtagaatatttgcttctccattagctaagaaaatggccgaggat
aaagggattgatctttctaaagtagaaggttccggagaaaatggaagaatcgttaaaaaa
gatatcgaatcttacaaaccttctgaggctcctgctccaaaagaaactaagaaagaagca
gaaacatcagtagctgctccttatgtgcctgctggtgaagaaagttttgaagaaattaag
aattctcaaatgagaaagacgattgcaaaacgtcttggagaatctaaatttagtgctcct
cattactatcttactatagaggtagatatggaaaatgcaatggcatccagaaagcaaatt
aacgagatgccagatgtgaaagtttcatttaacgatatggtgattaaagcaagtgcaatg
gcacttcgtaagcacccacaggtaaatagccaatggactggagatgctatgaaaatagcc
aaacatattcatatgggtgttgccgtagccgtagaagatggtcttgttgttcctgttctt
aaattcgcagatcaaatgtcgatgacgcagattggcggaaatgtaaaagatcttgccggt
aaagcgcgtaacaagaagcttcagccaaaagaaatggaaggaagtacctttacggtttct
aacttaggaatgtttggtattactgagtttacaagtattatcaatcagcctaactcagca
attctttcggtaggaacaattgtagagaaacctgtagtgaaaaacggagagatcgttgtt
ggtcataccatgaagcttaccttggcttgtgatcatagaacggtagatggtgccaccggt
gctgctttcttaaaggatcttaaaacttatattgagaatccagttactatgcttgcttaa

DBGET integrated database retrieval system