KEGG   Zunongwangia profunda: ZPR_4170Help
Entry
ZPR_4170          CDS       T01216                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
zpr  Zunongwangia profunda
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:zpr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4459303..4461153)
Genome map
AA seq 616 aa AA seqDB search
MRFLAKLILLFCLAVNTTQAQDEVFKIEDGNFKYKGEPIHIYAGEMHYARIPKAYWRHRL
QMIKALGLNAVNTYVFWNYHNTAPGKWDWTSGNKNLPEFIKMAKEEGLFVILRPGPYACA
EWEFGGYPWWLQKNPDLKIRQNNPAFLDSCRTYINEFATQVKPFQASNGGNVIMVQAENE
FGSFVAQREDISTEDHKAYKQKIFDMLKDSGLDGPFFTSDGTWLFKGGAIDGVLPTANGE
NNVANLKKAVNEYHNGEGPYMVAEFYPGWLDHWAEPFNKISAEAIAKQTEVYLKNDVDFN
FYMVHGGTNFGFTSGANYNDDHDIQPDITSYDYDAPISEAGWATPKYRAIRKLMKEYVAY
DIPEIPKQIPVISIPEIKLNKKQSALDVIKASKPVIADAPMSFEALDQGYGYVLYRKKFT
QPITGKLQIPGLRDYATVYVNGKYVGKLNRMYNEYEMDIKIPFNGTLEILVENMGRINYG
AKMTKNKKGIIKAVSINDYEISGGWEMYKAPFDSAPALSNEQEIKNGLPVLYSGNFDLEE
IGDTFLDMQKWGKGIVFVNGHHLGRYWKVGPQQTLYLPGCWLKEKGNTITILEQLNEDPK
STISGLEKPILDSLSQ
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttttagcaaaactcattcttcttttttgccttgccgttaatacgacgcaggcg
caagatgaggtttttaaaattgaagatggtaattttaagtataaaggagagcccatacac
atttatgcaggagaaatgcattatgctagaattccaaaggcttattggcggcatcgcctg
caaatgataaaagctttaggtttaaatgctgtgaatacttatgttttttggaattaccat
aatacagcaccgggaaaatgggattggacctcaggaaataaaaatctgccggagtttata
aaaatggctaaagaagaaggcctgttcgtaattcttcgccccggaccttatgcgtgtgcc
gaatgggaatttggaggttatccgtggtggcttcaaaagaacccggatcttaaaattcgt
caaaataacccggcttttttggattcctgtcgtacatatattaacgagtttgctactcag
gtcaaaccatttcaggctagtaatggaggaaatgtaattatggtacaggctgaaaatgaa
tttgggtcttttgtggcacaacgagaagatatttcaactgaagaccataaagcctacaaa
caaaaaatctttgacatgctcaaagattctggtttggacggtcctttttttacctcagat
ggaacatggttgtttaagggaggagcgatagacggggtattacccaccgcaaacggagag
aataatgttgccaaccttaaaaaagcggtaaatgaatatcacaacggagaaggtccttat
atggttgctgagttctatcctggatggctggatcactgggcagaaccgtttaataagatt
agtgccgaagcaattgccaagcaaacggaagtatatcttaagaacgatgtagattttaac
ttttatatggtgcatggcggaaccaattttgggtttaccagtggcgccaattataacgac
gatcatgatatacaacctgatatcaccagttatgattatgatgcaccaatttctgaagcc
ggatgggcaacgccaaaatatagggcaattagaaaattgatgaaggaatatgtggcatat
gatattcctgaaattccaaaacaaattccggtgatatccattccagaaattaaactaaat
aaaaagcaaagtgcactcgatgttatcaaagcatcgaaacctgtgatagctgatgcgccg
atgagttttgaagcacttgatcagggctatggttatgtgttgtatcgtaaaaaatttaca
cagcccattaccgggaagttgcaaattcccgggttgcgggattatgccacagtctatgtg
aacggtaaatatgtagggaaactaaaccgtatgtataatgaatacgaaatggatattaaa
attccttttaacggaactttagaaatcctggttgagaacatggggcgtattaattatgga
gcaaaaatgaccaaaaataaaaagggaattattaaagcggtaagtattaacgattacgag
atttctggtggttgggagatgtacaaagctccatttgatagtgcgccagcgttaagcaat
gagcaggaaatcaaaaatgggttaccggtattgtattcaggcaattttgatctagaagaa
ataggagatacatttttggatatgcaaaagtggggtaaaggaatagttttcgtaaatggt
catcatcttggtcgttattggaaagttggtccgcagcaaacactttatttgccgggatgc
tggttaaaagagaaaggaaatacgattacaattttagagcagctaaatgaagacccaaaa
tcgacaatttcaggtttagagaaaccgattttggacagcttgtctcaataa

DBGET integrated database retrieval system