KEGG   Zunongwangia profunda: ZPR_4178Help
Entry
ZPR_4178          CDS       T01216                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00511  Other glycan degradation
zpr00520  Amino sugar and nucleotide sugar metabolism
zpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ZPR_4178
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ZPR_4178
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ZPR_4178
Chaperones and folding catalysts [BR:zpr03110]
 Intramolecular chaperones
  Others
   ZPR_4178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b F5_F8_type_C Fn3_assoc CHB_HEX_C_1 Glycohydro_20b2 Glyco_hydro_97 CHB_HEX_C ANAPC10
Motif
Other DBs
NCBI-ProteinID: ADF54481
UniProt: D5BAF5
Position
complement(4476325..4478652)
Genome map
AA seq 775 aa AA seqDB search
MKLFKILLLFIALSTFGCAEKENPSFTKEELVLIPQPKSLNLNQGSFEVTNSTKIIIAQD
SLASVSSILNDLFKRAAGFELETSIDAHAENNIQLKINSEIAKEAYELKVTSENVILEAN
SKLGFVYGMETIRQLLPKEIESGSKVSDIEWYIPNVEITDAPQYSYRGNMLDVSRHFFGK
EYIKKHIDRLAFLKLNTFHFHLVDDQGWRIEIKKYPKLTEVGGFRVDQEDSHWNARTKNE
PDAKATFGGFYTQEDIKEIVAYAQERGIRVIPEIEMPAHVMSAIASYPWLSCTGEPIAVP
SGGVWPITDIYCAGKESTFEFLEDVLSEVMQLFPGEYIHVGGDEATKTNWKTCPDCQRRI
KEEGLADEDELQSYFMKRIEKFLNKNDRTLIGWDEILEGGLPEEATVMSWRGFEGGWEAS
AAGHDVIMTPTSHLYFDYYQGSPDNEPVAFNAFTPLKRVYEFRPVLDSMSVKQKKHVLGG
QANLWAEYVPTEAHSEYMLFPRLAALAEVVWSPENKLDWEDFSVRIRKMMERFEVMGINY
AKSAYAVQPESDIDLETGEITIKLKSEFPNTEIRYALNGEELNAESNLYENEIKVDTDTQ
LKAAVFKNGKVMGAVLDKTFKFHKAVAKPVIYKYPYNQNYASSGETALVNVLKGSKYFKD
GRWQGWINNPAIITIDLEKETSVSEVIVGSLEEQGTGIYFPQQLKVEVSKDGKNFKEVAS
LKRDYQTNPGAKIDNFKMGFELQENIRFVRVSVEPLAKTPNGGGAWLFLDEIQIK
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtttaaaattttacttctttttatagcgctttcaacatttggttgcgctgaa
aaggaaaatccttcatttaccaaagaggagttggtgctgattcctcagccaaaatcttta
aaccttaatcagggaagctttgaagtcactaatagtaccaaaatcatcattgcgcaagat
agtttagcctcggtttcttcaattttaaacgatctttttaaaagagctgccggatttgaa
ctggaaacttcaatagatgctcatgcagaaaacaatattcagctaaaaataaattcagaa
attgctaaagaggcttatgagcttaaggtaacttcagaaaatgtgattttagaagcaaat
tccaaactaggatttgtgtatggaatggaaaccatcagacaattacttccaaaggaaata
gaaagtggctcaaaagtatcggatattgagtggtatattcctaatgttgaaattaccgat
gcaccacaatattcatatcgtgggaatatgttagatgtttcccgccatttcttcggaaaa
gaatacattaaaaaacatatcgaccgactcgcatttctaaaactgaatacgtttcatttt
catttagtcgacgatcagggttggagaattgagatcaaaaaatatccaaaattaactgaa
gtcggaggctttagagttgatcaggaagatagccactggaatgcgagaaccaaaaacgaa
ccagatgccaaagctacgtttggtgggttttatacgcaggaggatattaaagaaattgta
gcctacgcacaggaaagaggcatcagggtaattccagaaatcgagatgccggcgcacgta
atgagcgctattgcttcgtatccttggttatcgtgtacaggagaacccattgcagttcct
tctggtggtgtttggccaattacagatatttattgcgcaggaaaagaatcgactttcgaa
tttttggaagacgtgctgagtgaggtgatgcaattatttccgggagaatatattcatgtt
ggtggtgacgaggccactaaaactaactggaaaacctgtcccgattgccaacgcagaatt
aaagaagaagggcttgctgatgaagatgagttgcaaagctattttatgaagcgtatcgag
aaatttttaaataaaaatgatagaacacttattgggtgggacgaaattttagaaggaggt
ttgcctgaagaagcgaccgtaatgagttggcgtggttttgaaggtggatgggaagcttct
gctgcaggtcacgatgtgattatgacaccaaccagccatttatactttgattattatcag
ggaagcccggataatgagcctgttgcttttaatgcgtttacgcccttaaagcgagtgtat
gaatttcgtccggttttagattcgatgagtgtgaaacaaaagaagcatgtattaggaggc
caggcgaatctttgggcagaatacgtgccgactgaggctcattcagaatatatgttgttt
ccaagattagcagctttagccgaggtggtttggagtcctgaaaacaagttagactgggaa
gatttctcggtaagaatacgtaaaatgatggagcgttttgaagtgatgggcatcaattat
gcaaaaagtgcttatgcggttcaaccagaatctgatattgatctggaaaccggagaaatt
acgatcaaattaaaatctgagtttccaaatactgaaattcgatatgctttaaacggagaa
gaattaaatgccgaatcgaacttatatgaaaatgaaataaaagttgataccgatactcag
cttaaagctgcagtttttaaaaatggtaaagtgatgggggcggttttagataaaactttt
aagtttcataaggcggtggcaaaaccggttatttataaatatccttataatcaaaattat
gcctcttcaggagaaacagcccttgtaaacgttttaaaaggaagtaaatattttaaagac
ggccgttggcagggttggatcaataatcctgcaattattacgattgatctggaaaaagag
accagcgttagtgaagtgattgtgggaagtttggaagagcagggcacagggatttatttt
ccgcagcaattaaaagtggaagtgtccaaagatggaaaaaactttaaggaggtagcttcc
ttaaaaagagattatcaaaccaatccgggagcaaaaatcgacaattttaagatgggattt
gagcttcaggaaaatatccggtttgttagagtaagtgtagaaccattagcaaaaactccc
aatggaggaggtgcatggttgtttttagatgaaattcagataaaataa

DBGET integrated database retrieval system