KEGG   Zunongwangia profunda: ZPR_4225Help
Entry
ZPR_4225          CDS       T01216                                 

Definition
(GenBank) ROK family member transcriptional repressor
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00010  Glycolysis / Gluconeogenesis
zpr00052  Galactose metabolism
zpr00500  Starch and sucrose metabolism
zpr00520  Amino sugar and nucleotide sugar metabolism
zpr00521  Streptomycin biosynthesis
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
zpr01120  Microbial metabolism in diverse environments
zpr01130  Biosynthesis of antibiotics
zpr01200  Carbon metabolism
Module
zpr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_4225
   00052 Galactose metabolism
    ZPR_4225
   00500 Starch and sucrose metabolism
    ZPR_4225
   00520 Amino sugar and nucleotide sugar metabolism
    ZPR_4225
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ZPR_4225
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ZPR_4225
Enzymes [BR:zpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ZPR_4225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK HP_OMP
Motif
Other DBs
NCBI-ProteinID: ADF54528
UniProt: D5BAK2
Position
complement(4533199..4534128)
Genome map
AA seq 309 aa AA seqDB search
MNIAIGADIGGTHITSAAIDLDSFSVIENSYYNQKIDNKSTKEVILKQWASCLNNSINAV
DLNSNHLLGVGIAIPGPFDYANGIGKYERNDKYESLYNVSIIDGLAREIQNSNIKLRFLN
DASSFGVGSDLLENLNEDHTIAITLGTGFGATFLKNKVPLITGNGVPENGCLWDKDFKDG
IADDYFSTRWLINHYGGLTGNDTAGCGVKELIDSDPENMKLVFTDFANNLCEFLYPHLKA
FDTDVLFIGGNIAKASSYFLDILEDCIAEGKLKTKIRIVTEAEKVGVIGAAYLFNPGFWD
RIRTELPSI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagccataggtgcagatattggggggactcatatcaccagtgcagccatagac
ttagattctttttcggtaatagaaaacagttattacaatcaaaaaatagataataaatct
acaaaagaagttatcttaaaacagtgggcatcctgtttaaacaattcgataaacgcagta
gatcttaacagtaatcatctccttggggtagggatagctatccccgggccttttgactat
gcaaatgggattggtaaatacgaaagaaatgataagtatgaaagtctttataatgtctcg
atcatcgatgggctagccagggaaatacaaaacagtaatataaagctgcgatttctaaac
gacgcttcttcttttggagtaggaagcgacctcttagaaaacttaaacgaagatcatact
atagcaattactctgggtacaggatttggagctacttttcttaagaataaggtgccttta
ataaccggaaacggagttcctgaaaatggttgtttatgggataaggattttaaggacggt
attgcagatgattatttttctacacgctggcttattaatcattatggaggtttaaccggc
aatgatactgccggttgtggtgtcaaagaacttattgatagtgatccggaaaatatgaaa
ctggtatttaccgattttgctaataatttatgtgaatttttatacccacaccttaaagct
tttgatacagatgttttatttattggtggaaatatcgccaaagcttcatcttattttctg
gacatacttgaggattgtatagctgaagggaaactaaaaaccaagattagaattgttacg
gaagccgaaaaagttggggtgataggcgctgcctatctctttaatcctggtttttgggac
cgaattcgtacagaattgcctagtatataa

DBGET integrated database retrieval system