KEGG   Zunongwangia profunda: ZPR_4378Help
Entry
ZPR_4378          CDS       T01216                                 

Definition
ROK family member transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
zpr  Zunongwangia profunda
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZPR_4378
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_4378
   00052 Galactose metabolism
    ZPR_4378
   00500 Starch and sucrose metabolism
    ZPR_4378
   00520 Amino sugar and nucleotide sugar metabolism
    ZPR_4378
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ZPR_4378
   00524 Butirosin and neomycin biosynthesis
    ZPR_4378
Enzymes [BR:zpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ZPR_4378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4709379..4710287)
Genome map
AA seq 302 aa AA seqDB search
MHSIGVDIGGSHITACIYDHTSKSIATDSLIYRKVNSRGSKNEIIEAWASAIDSCRKKVD
VKVEGVGVAMPGPFDYYNGISLIENVDKLSALYKVDIRNELARHLKIDPSKIRFINDATA
FSIAEAMIGCARDYRRVVAITLGTGLGASFLASGKPIIEDDRVPKGGFLYNQLYKGKVAD
ELFSTRGILRDYKERTGKSVTNVRRISELAREDEFAQNTMDQFGKDLGLFLAPFLKKFNA
EVLVLGGNISKAYPYFESSLSKQLPQINIEISEFGEQSAVIGSAILLDDHYYKEITPIIK
LM
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtataggagttgatattgggggaagtcatattactgcgtgtatttatgaccat
accagtaaatccatagctacagacagtttaatctaccgaaaagtaaattccaggggatca
aaaaatgaaatcatcgaggcatgggctagcgccattgattcctgtaggaagaaggtagat
gttaaagttgaaggtgttggtgttgctatgcctggcccttttgattattataacggtata
agtcttatagaaaatgtagataaattaagtgccctttataaggtggatatccgaaatgaa
cttgcaagacacttaaaaattgatccttctaaaattcgatttataaatgatgccactgcg
ttctcgattgcagaagcgatgattggatgtgccagggattataggcgggtggtggccatt
acattaggaacggggcttggggccagttttttggcctctggcaagcctataattgaagat
gatagggtgcccaaggggggctttttatataatcaattgtataaaggaaaagtagcagat
gagcttttttctactcgggggattcttcgtgattataaagagcgtacaggtaagagtgtg
acgaatgtccgtaggatttctgaactggctagagaagatgaatttgcacaaaacactatg
gatcaattcggaaaagatctggggctttttttagcgccttttttgaaaaagtttaatgca
gaggttttagttttaggaggcaatatctcaaaagcttatccatattttgaaagctcgtta
agcaaacaacttcctcaaattaatattgaaatatcggaatttggtgaacaatcggctgtt
attggtagtgctattttattagatgatcactattacaaagagataaccccaataataaaa
ctgatgtaa

DBGET integrated database retrieval system