KEGG   Zunongwangia profunda: ZPR_4392Help
Entry
ZPR_4392          CDS       T01216                                 

Definition
glycoside hydrolase 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
zpr  Zunongwangia profunda
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ZPR_4392
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ZPR_4392
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ZPR_4392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4732572..4734020
Genome map
AA seq 482 aa AA seqDB search
MKKILITIVIAATLIGCSDDDQKSYPPPTTGGSGNEVGTAQIWVTSGDESRLLSAQDHLS
IIDNKETSYPSITINETEQMQEIEGFGAALTGSSAYVINNLSTAQKNSLLSDLFDVESGA
GMSYLRLTIGASDFSLEDFTYDDMPQGQEDPNLDNFSIAHDEMHVIPVANDILSINPEVK
FMGSPWSAPAWMKDNESLYGGKLEEQWYATYANYFVEYIQAFENHGIPIDAITPQNEPLH
TSGYPTMRMEAQEQANFIKNALGPAFEGANISTKIIAYDHNFDEAGYPMTVLGDGEANPY
VSGSAFHAYAGDVSAMSQVHNAYPDKGLYFTEISGGEWSIDFSSNLRWYVQNILMGSTKN
WSKNALFWNLALNENHGPTNNGCQDCRGVVTINSSGEIEKNEEYYAIAHFSKFVRPGAHR
IGSSNFDDNSGLDGIAFQNPDGSKALIVLNETPTSKTFSVIMGENRFDYTLSSESVATIT
WE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatattaataactatagtaattgcagctacattaattggctgttcagatgat
gatcagaaaagttacccgccaccaacaaccggtggtagcggtaacgaagttggaacggca
caaatttgggttaccagtggcgatgagagcaggttgctttcagcacaagatcatctaagt
attattgataataaggagacatcatacccttccatcacaattaatgaaactgaacaaatg
caggaaatagaagggttcggagcagctttaaccggttcttctgcttatgtgattaataat
ttaagtactgcacaaaaaaacagtttgctttccgatttgtttgatgtagaaagtggagcg
ggaatgagttatttacgattaaccattggagcttcagatttttccttggaagattttact
tacgacgatatgccgcaaggacaggaggatcctaacctggataatttttctattgcccat
gatgaaatgcatgtaattcccgtagcaaatgatattttaagtattaacccggaagtaaaa
tttatgggaagtccttggagtgctcctgcttggatgaaagataatgaaagtttatacgga
ggaaaattagaagaacaatggtatgcaacctacgccaattattttgttgaatacattcag
gcttttgaaaatcatggaattccaattgatgcgattactccacaaaatgaacctctacat
acttcaggttatccaaccatgcgtatggaagctcaggagcaagctaactttataaaaaat
gcattaggacctgcttttgaaggagcaaatatttcaacaaaaattattgcttacgatcat
aattttgatgaagcaggttacccaatgaccgtcttaggcgatggagaagctaatccttac
gtctcaggcagtgcatttcacgcttatgccggagatgttagtgcgatgtcacaagttcac
aatgcttacccagacaaaggactttattttacggaaatttccggaggagaatggagtatc
gatttttccagcaacctaagatggtatgttcagaatattttaatgggttctaccaaaaac
tggtctaaaaacgctttgttttggaatttggccctcaatgaaaatcatggacctaccaat
aatggttgccaagattgtagaggagtggttaccattaattcttcaggagaaatagaaaaa
aatgaagaatactatgcgatagctcatttttcaaaatttgtaagaccgggtgcacatcga
attggctcttcaaattttgatgataattcaggcttagacggtattgcttttcagaatcct
gatgggagtaaagcattaatagtacttaatgaaactccaacttcaaagacattttctgtg
attatgggagagaatagatttgattataccctttcttcagaaagtgtagccaccatcacg
tgggaataa

DBGET integrated database retrieval system