KEGG   Zunongwangia profunda: ZPR_4610Help
Entry
ZPR_4610          CDS       T01216                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
zpr  Zunongwangia profunda
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ZPR_4610
Enzymes [BR:zpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ZPR_4610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4972272..4972919
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHEEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQNVEIFKPAVDTRYDEEM
VVSHDANEIRSTPVPSASNIRLLADGCDVVGIDEAQFFDDEIVSVCNDLANRGIRVVVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSYRKAINDDLVFLGETEEYEP
LSRAAYYKAMNQEKVRRMNVKDAEVIKPNLKEKNA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcacgaagagcaatttggctggatagaggttatttgc
ggtagtatgttctctggaaagaccgaggaacttatccgccgacttaaacgagcccaattt
gctaaacaaaacgttgaaatctttaaaccagctgtcgatacccgatacgacgaggaaatg
gtggtttctcatgatgctaacgaaattaggtctacccctgtaccttctgcatccaatatt
aggctattggccgatggttgtgatgtagttggaatagacgaagctcagttttttgatgat
gaaattgtaagcgtttgtaacgatcttgctaataggggaatccgagttgtggttgcgggc
ctggatatggattttaaaggaaatccttttggtcccatgcccaatcttatggctacggca
gaatatgtaaccaaagtacatgccgtttgtacccgtaccggaaaccttgcccaatatagc
taccgaaaagccataaacgacgatttggtttttcttggcgaaactgaagaatacgagcct
ttaagcagagcagcttattacaaagcgatgaaccaggaaaaagttagaagaatgaatgtg
aaagatgccgaagtgataaagcctaacttaaaagaaaaaaatgcctaa

DBGET integrated database retrieval system