KEGG   Zygosaccharomyces rouxii: ZYRO0A01144gHelp
Entry
ZYRO0A01144g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZYRO0A01144g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0A01144g
   00020 Citrate cycle (TCA cycle)
    ZYRO0A01144g
   00620 Pyruvate metabolism
    ZYRO0A01144g
Enzymes [BR:zro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ZYRO0A01144g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:82681..84063
Genome map
AA seq 460 aa AA seqDB search
MSALIRAAVPRVARISLASRLALRCYASYPAHTVIGMPALSPTMAQGNLAQWSKKEGEQI
GAGDVLAEIETDKATMDFEFQDEAYLAKILVPEGTKDIPIGKPIAVTVEDGGDVDAFKDF
KVEESAPKEEPKKEEPKKEESSADAKPTPAPSQSASKVAAPPTDRIVASPLAKTIALDKG
ISLKSVNGTGPNGRITASDVEAFLSKAPAAGAGGAAGASSASGAATETYEDEPISNMRSI
IGRRLLESTQSIPSYIVSSDISVSKLLKLRKSLNASAKDQYKLSINDILIKAITVAARRV
PDANAYWLQDQGIIRSFKNVDVSVAVATPTGLLTPIIKNAESKGLVSISGEVKEKVARAK
INKLKPEEFQGGTICISNMGMNNAVSLFTSIINPPQSTILAVSTVKRVAVEDAGAENGIS
FDDQMTITGTFDHRTIDGAKGGEFMRQLKNVVENPLELLL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccctcattagagcagcagtccccagagttgcaagaatctcattggcatcgaga
ttagcattgagatgttacgcttcctatccagctcataccgttatcggtatgccagctcta
tcaccaactatggctcaaggtaacttggcccaatggtcaaagaaagaaggtgagcaaatt
ggtgcaggtgatgttcttgcagaaattgaaactgataaggcaaccatggattttgaattt
caagacgaagcttatttagcaaaaattttagttcctgaaggtaccaaggatattcctatc
ggtaaaccaattgcagtcactgtggaagacggtggtgatgttgacgcattcaaggacttc
aaagtggaagaatcagctccaaaggaggaaccaaagaaggaagaaccaaagaaggaggaa
tcttcagctgatgctaaaccaacaccagcaccttctcaaagcgcttcaaaggtcgctgcc
ccaccaactgacagaattgttgcatccccattggccaagactatcgctttggacaagggt
atctctttgaagagcgtgaatggtaccggtcctaatggtagaatcacagccagcgatgtg
gaagcattcttgtccaaggctcctgctgctggtgcaggtggtgctgccggtgcttcctct
gcatccggtgctgctactgagacttacgaggatgagccaatttctaacatgagatctatc
atcggtagacgtctattggaatccactcaatcaattccttcatacattgtttcctctgat
atttctgtatccaaattgttgaaattgagaaaatccctaaatgcttccgctaaagatcaa
tacaaactatctattaatgacattttgatcaaggctattaccgttgccgcaagacgtgtt
cctgatgctaatgcctactggttgcaagatcaaggtatcattagatcttttaagaatgtc
gatgtttccgttgcagttgccactccaaccggtctattgactccaattatcaagaacgcc
gaatctaagggtttggtttccatctctggtgaagttaaagaaaaggttgctcgtgcaaag
attaacaaattgaaaccagaagaattccaaggtggtaccatctgtatctctaacatgggt
atgaacaacgctgtttctttgtttacttccattattaacccaccacaatctactatcttg
gctgtttctaccgttaaaagagttgctgtggaagatgctggcgctgaaaatggtatctct
ttcgatgaccaaatgactatcactggtacttttgatcacagaaccatcgatggtgctaaa
ggtggtgaattcatgagacaattgaagaatgtcgttgagaacccattggaactgctattg
taa

DBGET integrated database retrieval system