KEGG   Zygosaccharomyces rouxii: ZYRO0A02420gHelp
Entry
ZYRO0A02420g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ZYRO0A02420g
Peptidases [BR:zro01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ZYRO0A02420g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:190417..192654
Genome map
AA seq 745 aa AA seqDB search
MSFVLGPIVQKISSFISNNNNKTSIPIALGIVILSTAFLFLKSKKHNSNVGDIARGMTSK
SGFRRWMPRSGQMENEVLKRGGNIGGLVNDGNTCFMNCVLQSMASSKELLKFLDEEIACK
AKLDEDQSNGDDVNNEKPHNTSKQQQKREEEAKSEGETVPDVTFSAALKELLDKLNAKYY
RDRPYFKANKLLKSMSKAPNKNILLGYDQEDAQEFFQTMLSELEKNAKSLDNTTIDKHAI
LEKDLPETAVIGQARLDHVGAVYIPTEQVTPNLIPPGSKEKYFTKFKLITPLDGILAERI
GCLQCGETGGIRYSVSSGLSLNLPSDNMGSSLKLSDLLKDYIKPEIIEGVECNRCALIAV
RDHLKEQLQQYEDKKANAIPAKLCQAFQSRIQELEKVLSKPVIDDEEYKKLHTENMVRKS
SKSKQVLISRPPPLLAIHINRSVFDPRTFMIRKNNARVLFKSRLNLSPWCCDIDEINMDA
RMPMSQKEEVIMDSSEDENVGGEFYTKLHQKYEREFEDSDEDSDQPIGSSDDKLVSNYDP
LGGDGNSLSSYSDEEESNESDYIEKTDALGNTIREPRARANDKVEVAVRENASGASSSEE
EEEPEDKNQEMDGDDEDERASAPQNTESEGEDEGEATNGPLPSKFSVPATPLTYSLRSVV
VHYGTHNYGHYIAFRRYRGYWWRISDETVYIVDETEVLSTPGVFMLFYEYDYDESTGQTK
QEDWQLEEEYNPEKIEIAGEPESLS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgttttgggacctatagtacaaaaaatctcctcattcatttcaaacaacaat
aataagactagcatcccaatcgcattaggtatagtaattctatcgactgcatttttattt
ctaaagagtaagaaacataattctaacgtaggtgatattgcaagaggaatgacatcaaaa
agtggatttagacgttggatgcctcgttctggtcaaatggaaaatgaagttttgaaaaga
ggtggtaacatcggtgggttggtaaatgatggtaacacctgttttatgaattgtgtttta
caatcgatggcatcttctaaagaacttctgaaatttttagatgaagaaattgcatgcaaa
gcaaaattggatgaagatcaatcaaacggagatgatgttaataatgaaaaacctcataat
acatcaaaacaacaacagaagcgagaggaagaggcaaagagtgaaggtgaaaccgttcca
gatgttacatttagcgctgcccttaaggagttgttagataaattgaacgccaagtattac
cgtgacagaccttattttaaagccaacaaactcttgaaatcgatgtctaaagcgcctaat
aaaaatattttattaggttatgatcaggaagatgcacaagagtttttccaaaccatgctt
tcagagctggagaaaaatgcaaaatccttggataacactactatagataaacatgcaatc
cttgaaaaggatttaccagaaaccgctgtcataggtcaagcacgtctagaccatgtgggt
gccgtctatattccaaccgaacaagtgactcccaatttgatcccacccggtagtaaagaa
aagtattttaccaagtttaaattgattacaccattggatggtattcttgcagaaagaatt
ggttgtttacagtgtggtgaaaccggtggtattcgttactcagtatcatctggattaagt
ttaaacttaccaagtgataatatgggatcatcgttaaaattatctgatcttttaaaggat
tacattaaacccgaaattattgaaggtgtagaatgtaatcgttgtgcattgattgccgtt
cgtgaccatttaaaggaacaattacagcaatatgaagataaaaaggctaatgcaatacct
gctaaactatgtcaggcattccagtccagaattcaagaattggaaaaagttttgagtaag
ccagttattgatgatgaagaatataaaaagcttcacacggaaaacatggtccgtaaatct
tctaagtccaaacaagtgctgatatcaagaccaccacctttactggcgattcacatcaat
aggtccgtctttgaccctcgaactttcatgatcagaaaaaataatgctcgtgttcttttc
aagtcaagattgaacctatcaccatggtgctgtgatatcgatgagattaatatggatgca
cgtatgcctatgtctcaaaaagaagaagttattatggattcaagcgaagatgaaaatgtt
ggtggtgaattttacactaaattacatcaaaaatacgaaagagaatttgaggatagcgat
gaagattccgatcaacccattggtagcagtgatgataaacttgttagcaactatgatcca
ttgggtggtgatggtaactcgctatcatcgtactcagatgaagaagagagtaacgaatct
gattacatcgaaaagactgatgcactcggtaatacaattagagaacctagggcaagagct
aatgataaagtggaagttgcagtccgtgaaaatgcttcaggtgcttcttcatctgaagaa
gaagaagaacctgaagataaaaatcaagagatggatggtgatgatgaagatgagagagca
tcagcgccacaaaacactgaaagtgaaggcgaagatgaaggtgaagctaccaatggccca
ctaccatctaaattttctgtaccagctactcccttaacatactcgctacgttctgtagtg
gttcattacggtacacataattacggtcattacattgcctttagaagatacagaggttac
tggtggagaatcagtgatgagaccgtttatatcgttgatgaaactgaagtattgtccaca
ccgggtgtctttatgttgttttacgaatacgattacgatgagagcactggtcaaacaaag
caagaagattggcaacttgaagaagaatacaatcctgaaaaaatagaaattgctggagag
cctgaaagcttatcatga

DBGET integrated database retrieval system