KEGG   Zygosaccharomyces rouxii: ZYRO0A03080gHelp
Entry
ZYRO0A03080g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZYRO0A03080g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ZYRO0A03080g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(250211..251482)
Genome map
AA seq 423 aa AA seqDB search
MRLIYTLTLSVATLGRFVSASVLPQHGFEAEVDNTSLVDQLYGDLLISREGFEMQSLHSK
ITPSDEDDEEFRARCGFYNENPVQLPSDGLGSDLVIFAGIVSFAHLPIARCFTPGAEDFD
IAIVGAPYDTSTSFRPGARFGPNGIRQGSRRLGSGVSPVRGFPGSKLRQLDPYNAGYKLV
DCGDVPMSPFDNRVALNQLYRGQRTIHKNKSVKDPSQPPKIITLGGDHTVTLMNLRSAYE
QWGRLAVIHFDSHIDSWDPRVLGGNITKSTALNHGTFLHYAHEKGYLAPNNSIHVGIRAP
FLGPDDEKHDFECGFEKIVARDIDIVGIKGIVDRIKQHVTGWPVYLTLDIDSIDMAVAPG
TGTPEPGGFSAREILTILDGLEGLNIVGADVVEVAPAYDTNGDITSTIAASVVDSILGLM
TID
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgatctacacgttaacattatcagtcgccactttgggccgtttcgttagtgcc
tctgttttaccccagcacgggtttgaagccgaagtcgacaatacatcactagttgatcaa
ctttatggtgacttgcttatctctcgagaaggatttgagatgcaatccttgcattctaag
atcactccatcagacgaagatgatgaggagtttagagctcgttgcggattttataacgag
aacccagttcaattgccaagcgacggacttggttcagatttagtaatttttgctggtata
gtttcgttcgcacacttaccaattgctcgctgctttacacccggcgctgaggattttgat
attgccattgtgggggcaccctacgatacttccacttcttttagaccaggtgcacgcttt
ggtcctaatggcattaggcagggttctcgtcggttaggtagtggtgtatcacctgtaaga
ggtttccccggctctaaattgcgtcaattggatccatataatgccggttacaaattagtc
gattgcggagatgtacccatgtccccattcgacaacagagtagcgttaaaccagctgtat
aggggtcaaagaactatccataaaaacaaaagtgtcaaggatcctagtcaaccaccaaaa
attattactctcggtggtgatcataccgtaactttgatgaatttgaggtccgcttatgag
caatggggtcgtttagcggtaattcacttcgattctcatatcgattcatgggatcctaga
gtcttgggtggtaacattacgaagtctacagctctaaatcatggtacctttttacattat
gctcatgaaaagggttatttagcacctaacaattctatccacgttggtataagagcacct
tttctcggacccgatgatgaaaagcacgatttcgaatgtggatttgaaaaaattgttgca
agggatattgacattgtaggtatcaagggcatagtagatcgtatcaagcagcatgttact
ggatggcccgtgtatctcactctagatatcgacagtatcgatatggcggtagcaccggga
acaggtactccagaaccaggtggatttagtgctagagaaattttaaccattttggatggt
ttagaaggtcttaacattgttggtgctgatgtagtagaagtagcaccagcttacgatact
aatggtgatattacaagcaccatagccgccagtgtagttgactccatactgggtctaatg
acaatagattaa

DBGET integrated database retrieval system