KEGG   Zygosaccharomyces rouxii: ZYRO0A04444gHelp
Entry
ZYRO0A04444g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
zro  Zygosaccharomyces rouxii
Brite
Chromosome and associated proteins [BR:zro03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    ZYRO0A04444g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ZYRO0A04444g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W
Motif
Other DBs
NCBI-GeneID: 8201918
NCBI-ProteinID: XP_002494564
UniProt: C5DPM0
Position
A:361844..362242
Genome map
AA seq 132 aa AA seqDB search
MSAKAEKKPASKAPAEKKPAAKKTASAVESKGRKNKARKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIATEASKLAAYNRKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSSTQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaaagccgaaaagaagccagcctccaaggccccagctgagaagaagccagct
gctaagaagaccgcatctgctgttgagtctaagggtagaaagaacaaggcaagaaaggag
acctactcctcttacatttacaaggttttgaaacaaactcatccagacactggtatctct
caaaaatccatgtctattttaaactccttcgttaatgatatctttgaaagaattgctacc
gaagcttctaaactagctgcttacaacagaaagtctactatctctgctagagagattcaa
actgctgtaagactaattttgccgggtgaattggctaaacatgccgtgtctgaaggtact
agagctgtgactaagtactcttcttctactcaggcttaa

DBGET integrated database retrieval system