KEGG   Zygosaccharomyces rouxii: ZYRO0A05324gHelp
Entry
ZYRO0A05324g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZYRO0A05324g
   01230 Biosynthesis of amino acids
    ZYRO0A05324g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0A05324g
  Energy metabolism
   00680 Methane metabolism
    ZYRO0A05324g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZYRO0A05324g
Enzymes [BR:zro01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ZYRO0A05324g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ZYRO0A05324g
  Exosomal proteins of melanoma cells
   ZYRO0A05324g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(434078..434983)
Genome map
AA seq 301 aa AA seqDB search
MTIESNTFKLILLRHGQSELNHENIFCGWIDAGLTQKGKDQAKNAANLIIDYCQTHSIPL
PQVGYISRLVRTRQTMEVILAEMNLKGSYEVVSGSNYEPKGQLKQGYTSVLETWRLNERH
YGSWQGKRKPDVLKEYGEDQYMYIRRDYEGKPPHVDLNREMLQEVNDQGSSTGYDFKEPN
RHLKYNIEEQIGEELPASESLKDVVQRLEPFIRNVVIPTSQKNNLDSSLIIGHGSSVRSI
LKILQGISDEDIKSVDIANATPLVVELDKQNFTFVRRYYLDPEKAKIDAEKVRREGFQSN
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaagtaatacttttaagttgatcctgttaagacatggtcaaagtgaatta
aaccatgagaatatcttctgtggatggatagatgctggactcacacagaagggtaaagat
caggccaaaaatgcagctaatttgattatagattattgtcaaacgcatagcataccatta
ccacaagttggctacatatcaagattggtgaggacaagacaaaccatggaagttattctt
gctgaaatgaatttgaagggctcttatgaagtagtttcaggatctaattatgagcccaag
ggacaattaaaacagggatatacatctgtactagagacatggaggttaaatgaacgtcac
tatggttcttggcaaggtaagaggaaacctgacgttttaaaagaatacggtgaagatcaa
tacatgtacatcagaagagattatgaaggtaaaccaccacatgttgatcttaatcgtgag
atgttgcaagaagttaatgaccagggatcttcgactggttatgatttcaaggaaccaaat
agacatttaaagtacaacattgaagaacagattggtgaagaattacctgcaagtgaatct
ctgaaagacgtggtgcaaagattggagccattcatacgtaatgttgtgattcccacatct
caaaagaacaatttggattccagtttaattattggacacggtagctctgtgaggtccatt
ttaaagatcctccaggggatctccgacgaagacattaagagtgtagacattgccaatgcg
acaccattggtcgtggaattggataagcagaatttcacatttgtgagaagatactacctg
gatcctgagaaggcaaagattgatgctgaaaaggtacgtagagaagggttccaatctaat
ccgtaa

DBGET integrated database retrieval system