KEGG   Zygosaccharomyces rouxii: ZYRO0A06138gHelp
Entry
ZYRO0A06138g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00860  Porphyrin and chlorophyll metabolism
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZYRO0A06138g
Enzymes [BR:zro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ZYRO0A06138g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 8201560
NCBI-ProteinID: XP_002494637
UniProt: C5DPU3
Position
A:complement(490489..491241)
Genome map
AA seq 250 aa AA seqDB search
MQRAILLKNKTAQQDKYEIEFQSNGFEPVFIPLISHTHIPQGLLKLLEDDAYLKDLQDII
VTSQRTVECLYESVLPQLHASTRQLFLEKTVYAVGPSTKDFLIRIGFKNVKGGEDAGNGS
ILSDIIISDYREQGKNSEPLLLVGEIRRDIIPKKLSSNGIQVKEVITYKTENLPDNLTRF
QAMARENSWVVFFSPQGTEEIIESIKNGSNHRVASIGPTTEEFLQRKGLEPDVVSLKPDE
RNLVNAILSI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagccattttactcaagaataagactgctcaacaggataaatacgaaattgaa
tttcaatcgaacggtttcgagcctgtcttcatcccattgatctcacatacgcatattcct
caaggattattgaaactgctagaagacgatgcttatttgaaggatttacaagatatcatt
gtaacatctcaacgaacagttgaatgcctttatgaatcagttttacctcaattgcatgca
tcaacaaggcaacttttcctcgagaagaccgtctatgctgttggtcctagtaccaaagac
tttttaatacgtatcggatttaaaaatgtaaaaggtggtgaagatgctggtaacggcagc
attttatcagatatcataatttcagactatcgtgagcaaggtaagaattcggaaccttta
ttattggtgggtgaaattagaagggacataatacccaagaaattatcaagtaatggtatt
caagttaaagaagtcatcacttacaagactgaaaatttacctgataatttgacaagattc
caggcaatggcaagggaaaatagttgggtagttttctttagtcctcaaggaactgaagaa
attatagaatctatcaaaaacggtagtaatcatagagtcgccagcatcggtcctaccaca
gaagaatttctacagagaaaaggtcttgaacctgacgtggtgagtctgaaacctgatgaa
cgaaatttggtaaatgcaattctatccatttag

DBGET integrated database retrieval system