KEGG   Zygosaccharomyces rouxii: ZYRO0A08910gHelp
Entry
ZYRO0A08910g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
zro  Zygosaccharomyces rouxii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:711674..712612
Genome map
AA seq 312 aa AA seqDB search
MSHDGEGLYGILNERNIKEVQFGVDKRFPTWYGSNVYFDPESRALGYLEKNGSDGLSGSN
GTNGHNKGDVQFWLDTLYVCEYCFKYTDNEEDLAGHAKHCRFQKHSPGKIKYKSPNYTIK
RVKGTKHRLFCQCLCLFTKLFLDNKSMYFKVDHYEFYIVYETSSTKPMGFFSKDTVSYYQ
NNLACVLVFPPYQRRQLGTFLLDFSYKISKSEGLISGPEFPLSPFGLIGYVKYWSLKICW
EFSEGELANMEKITLENISSVTGFRISDIITALKYLGCLGESDEIYLSILRKKLNRHSCE
ALVEDEYLLLDD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgatggtgaaggtctttatgggattttgaatgaacgaaacattaaagaagtc
caatttggtgttgataagagatttccaacctggtatggtagtaatgtgtattttgatccc
gagagtagagctttaggatatttggagaaaaatggatcggatggattgagtggatcaaat
gggaccaacggtcataataaaggtgatgtccaattttggctcgatacactttatgtatgc
gaatattgtttcaaatacactgacaatgaagaggatcttgctggccatgccaagcattgt
agattccaaaaacattcacctggaaaaataaaatataaaagtccgaattataccatcaaa
agggtaaaaggaacaaaacatcgtctattttgtcagtgcctatgtctttttaccaaactt
ttcctcgacaacaaatccatgtactttaaagtagatcactacgaattttatatcgtctat
gagacttcgtccactaaaccgatgggatttttctccaaagacacggtttcttactaccaa
aataatctggcctgtgttctagtttttcctccttatcaaaggcgccaattgggtacattt
ctcttagatttttcttacaaaatatcaaagtctgaaggtttgatatcaggacctgaattt
cccctctcaccatttggattaattggatacgtgaaatattggtctttaaagatatgttgg
gaattttctgaaggtgaattagctaacatggagaaaattaccttagagaatatatcttca
gtaacagggtttcgaatcagtgatataattactgctttaaagtatctcgggtgcttggga
gaatctgatgaaatttatttgtctatacttagaaaaaagctgaacagacatagctgtgag
gctctagtagaagatgagtatttgctgttagacgattaa

DBGET integrated database retrieval system