KEGG   Zygosaccharomyces rouxii: ZYRO0A09702gHelp
Entry
ZYRO0A09702g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
zro  Zygosaccharomyces rouxii
Brite
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ZYRO0A09702g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(784576..784974)
Genome map
AA seq 132 aa AA seqDB search
MSAKAEKKPASKAPAEKKPAAKKTASSVEGKGKKNKARKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIATEASKLAAYNRKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSSTQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaaagctgaaaagaaacccgcttccaaggccccagctgaaaagaagccagct
gccaagaaaaccgcatcttctgtcgaaggtaagggtaagaagaacaaggcaagaaaggag
acctactcctcttacatttacaaggttttgaagcaaactcacccagatactggtatttct
caaaagtccatgtctattttgaactccttcgtcaacgatatctttgaaagaatcgctacc
gaagcctctaaattagctgcttacaacagaaagtctactatctctgccagagaaatccaa
actgcagttagattaattctaccgggtgaattggctaagcacgccgtttccgaaggtact
agagctgttaccaagtactcctcttcaactcaggcttaa

DBGET integrated database retrieval system