KEGG   Zygosaccharomyces rouxii: ZYRO0A12826gHelp
Entry
ZYRO0A12826g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     ZYRO0A12826g
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   ZYRO0A12826g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ZYRO0A12826g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:1014651..1015751
Genome map
AA seq 366 aa AA seqDB search
MPRTITFDIPSQYQLVALIGEGAYGTVCSAIHKPTGIYVAIKKIQPFSKNMFVTRTLREI
KLLSYFHDHENIISILDKVRPTSIDKMNAVYLVQELMETDLQRIISNISTNPLSDDHIQY
FTYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDSRETLVGFM
TEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAELVSGKPLFPGRDYHHQLWLILEVV
GSPTYEDFESIKSQRAKEYISNLPLKAKLPWDVVLGKQNLNPDMVDLLDRMLAFNPNKRI
SAAEALNHPYLAMYHDPEDEPEYPPLNLEDDFWKIDNEIKKPNEDGEISIDVLKAMLYDE
IMKRTD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtaccattacttttgatatcccatcacaatatcaactagtggctcttatcggt
gagggagcctacgggacagtatgttcagcaatccacaagccaactggcatctatgttgcc
attaaaaagattcaaccatttagcaagaatatgttcgttacaagaacgctacgtgagatc
aaactgttaagttatttccacgaccatgagaatataattagcattttggataaagtcagg
ccgactagcattgataagatgaatgccgtgtatctggtacaggagttgatggaaacagat
ttacagaggatcattagcaacatctctacaaatcccctaagcgatgatcacattcaatat
ttcacatatcagatattgagagcattaaaatcgattcattctgctcaggtaattcatagg
gatttaaaaccatctaatctgttgttaaattccaattgtgatttaaaagtttgtgatttt
ggtctatcgagatgcctagcaagcagtagcgattcaagagagaccttggtagggtttatg
acagaatatgtggctacacgttggtatagagcacctgagattatgttaactttccaagaa
tacacgactgcaatggatatatggtcgtgtgggtgcatattggcagaattggtgtcaggt
aaaccacttttccccggtagagattatcaccatcagttgtggttaatcttggaagtggtg
ggttcacccacttatgaggactttgaatcgatcaaatctcaaagagccaaggagtacatt
tctaatttgcctttgaaggcaaaactaccgtgggatgttgtgctggggaagcaaaatcta
aatcctgatatggttgatcttttggatagaatgttagcatttaatccaaataaaagaatt
agtgctgcagaagcattaaaccatccatatttggcgatgtatcacgatccggaggatgaa
cctgaatacccaccattaaacttggaggatgacttctggaaaatcgacaatgaaattaaa
aagcccaatgaagatggtgaaatttcaatagacgttttgaaagcgatgttatatgatgaa
attatgaaacgcacagattaa

DBGET integrated database retrieval system