KEGG   Zygosaccharomyces rouxii: ZYRO0A13420gHelp
Entry
ZYRO0A13420g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ZYRO0A13420g
Transfer RNA biogenesis [BR:zro03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    ZYRO0A13420g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:1065494..1067179
Genome map
AA seq 561 aa AA seqDB search
MAPGRKGPKTNKPKLAPEKERFVQCCADITLELTGSLTSGKTSEINLNGLITKYSKKYKL
KQQPRLTDVINAIPDQYKKYLLPKLKAKPVRTASGIAVIAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQLKQLGHSIDKVEYIIMG
GTFMSLPKDYREDFVTKLHNALSGYNGNDIDEAIQYSQQSLTKCVGITIETRPDYCTQTH
LDDLLKYGCTRLEIGVQSIYEDVARDTNRGHTVRAVCETFSVAKDCGYKVVSHMMPDLPN
VGMERDIEQFKEYFENPAFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYNANALVDLVAR
ILALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTKCRDVRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKRYTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAREEHGSEKISVISGVGVRNY
YTKLGYDLDGPYMSKRISCDD
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggctcctggtcgtaagggtcctaaaactaataagcccaagctggctcctgaaaaggag
agattcgttcagtgttgtgctgatattacattagagttaaccggttcgcttacatctggt
aagacatcagagattaatttgaacggacttatcacaaaatattccaagaaatacaagttg
aaacaacagccaagacttacagatgtcattaatgccattccagaccagtataaaaaatat
ttattacctaaattaaaagctaaacccgtgagaaccgcttcaggtatagctgttatcgct
gtcatgtgcaagccacacagatgtccacacatcgcatatacggggaatatttgtgtctat
tgcccaggtggtcctgattctgattttgaatattctactcaatcttataccggttatgaa
ccaacatctatgcgtgccattagagctcgttacgatccgtatgaacaagctcgtggtcgt
atcgaacaattgaaacaattaggtcactctattgataaagtagaatatatcattatgggt
ggtactttcatgtcgttaccaaaggattatcgtgaagattttgtgactaaactacacaat
gcactttcaggctacaatggtaatgatattgatgaagctattcaatattcacagcaaagt
ttgactaaatgtgttggtattaccatcgagacacgtccagattattgtactcaaacacat
ctagacgatcttttaaaatacggttgtacaagattagaaattggtgttcaatccatctac
gaggatgtcgctagagatacaaatcgtggtcatactgtaagggcagtttgtgagacgttc
agtgtcgccaaagattgtggttacaaagtggtctctcacatgatgcctgacttacccaac
gttggtatggaacgtgatattgaacaattcaaggaatatttcgaaaatcctgcattccgt
acagatggtttgaagatttatcccactttagtgattagaggtaccggtctttacgaactt
tggaaaactggtaggtataagtcttacaacgctaatgcattggtggatctcgttgcaaga
atcctagcacttgtgccaccttggactagaatttacagagtgcaaagagatattccaatg
ccattggttacttctggtgtggataatggtaatttaagagaattagctttggcgagaatg
aaagatttcggtactaaatgtcgagacgtgcgtacgagagaggtcggtatccaagaagtt
catcataaagtacaacctgatcaagtagaattaattcgtagggattattatgccaatggt
ggctgggaaacatttttgtcctatgaagatccaaagaaagatatcttaatcggattgcta
cgattgcgtaaagccagtaagcgttacacttaccgtaaagagtttacttcacaaagaacg
tcgattgttagagaattacacgtttatggtagtgtggtaccactacactctagagatcct
cgtaaatttcaacatcaagggtttggtactttattgatggaagaagcagaacgtatcgct
agggaagagcatggatctgagaaaatatcagtgatctccggtgtcggtgttaggaactac
tacaccaagttgggttacgatcttgatggtccatacatgtcgaagcgtataagctgtgat
gactaa

DBGET integrated database retrieval system