KEGG   Zygosaccharomyces rouxii: ZYRO0B00638gHelp
Entry
ZYRO0B00638g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
zro  Zygosaccharomyces rouxii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:42738..44930
Genome map
AA seq 730 aa AA seqDB search
MRSFMSSHIGRKRNRNTSVNNNNNTAIGNIDSTTQMESLMQGMLAKQDSILNGNLSDGLM
YDQQPFIDNENLQQPIDENENDTSNVADDEDDDVIFVKEQPVYLASPTVPGGDPNYDSNN
HYTSTTSKKFKKQRTISLPQLPHARLLYQNGNHKEFRGQNNDELLHLTGSSSRTLDGNRA
LSLRVVHSTSPDDVTLSERFYSSVSPAESAAISGESSESSSSNSVKGNGIGVEGATASGA
SLKGGNNPHKRTLHRLSAPKLAARLVGKKPKTRKRENFKTDKDGHYVYRQEDVFGGGRFV
VKGLLGQGTFGKVLKCTDSGDFIMNSNPFKLNTNLVAVKVIRAIDRYREAAKTELRVLQA
IRENDIPGQYQCLMLQECFEYRNHVCIVTDLLGRSVYDFMCSNGVARFPGSQVQAMAKQL
IRSVCFLHDLGIIHTDLKPENVVLCDESYVEKDLPPSVVRSLSSRRRDASGGKRKLLTNP
EIKVIDFGSAVFHREYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVTGESLY
PTHENLEHMAMMQRVNGEPFPPKIVGKMFYKASHNLGNAPADLNATVVKHFDKKTFALQW
PEKNKRGDYLTKDRSIRRVMDNCDRLDFLISNKLKADYGDWLSIDWNLSPEKNWALIKSR
ILTERRTTGTTAGDLNKETFLFWYWFIDLCRKMFEFDPTKRITAKEALDHKWFNLGILDE
GITSFGELQY
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcctttatgtcttcacatatagggaggaagagaaatcgtaatacaagtgttaat
aataataataatacagccattggtaatattgatagtacaactcaaatggaatcattgatg
caaggaatgctcgcgaaacaggattcaattttaaatgggaatctgtcagatggcctgatg
tatgatcaacagccatttattgataatgagaatttacaacaaccaattgacgaaaacgaa
aatgacacttcaaatgttgctgatgatgaggatgacgatgtgattttcgtaaaagagcag
cctgtctatttagcatcgcctacagtaccgggaggtgatccaaattatgacagtaacaat
cactacacctctacgacatccaaaaaatttaagaaacaaagaactatttcgttaccacag
ttgcctcatgccagattattgtatcaaaatgggaatcacaaggagtttagaggtcagaat
aatgacgaattattgcatttaactggctcttcttcacgcactttggatggtaacagggca
ctatcactgcgtgtggttcattcgacctcacctgatgatgtaacgttatcggaaaggttt
tattccagtgtatcacctgcggaatccgctgccatctcaggtgaatcctcagagagttca
tcttcgaattctgtcaagggtaatggtattggtgttgaaggtgcaactgcaagtggcgca
tccttaaaaggagggaataatcctcacaaaagaacattacatagattgtctgctcctaag
ttagctgcaaggttagttggtaagaaaccaaagaccagaaaacgtgaaaatttcaaaact
gataaagatggacactacgtctatagacaagaggatgtctttggcggtggcagatttgtc
gttaaaggtttactagggcaaggtacgtttggtaaagttttgaaatgtacagactccggt
gattttattatgaatagcaatccgttcaaattgaacacaaatttggttgcggttaaggtt
attagagctatcgataggtacagagaggctgcaaagactgaattaagagttttacaagcg
attagagagaacgatatcccgggtcaataccagtgtctcatgttacaggaatgttttgaa
tacaggaatcacgtttgtattgttactgatttgctgggcagatcagtttatgacttcatg
tgtagtaatggtgttgcgagatttccaggatctcaggtacaggcaatggcaaaacaacta
atacggtcggtatgtttcttacacgatttgggcattattcacacagatttaaaacccgaa
aatgtggttctttgtgatgagagttatgtggagaaagatcttccgccttctgtggttaga
tctttaagttcaagaagaagagatgctagtggtggtaagcgtaaacttttaacaaatcca
gagattaaggttattgatttcggcagtgctgttttccatagagaataccatccgccagta
atatcaacacgtcactatagagcccctgagattgttttgggattaggttggtctttcccc
tgcgatatttggtctattgcatgtgttcttgttgaattagttactggcgaatcgttatac
ccaacccatgaaaatttagaacatatggcaatgatgcaacgtgttaatggagagcctttt
ccaccaaagattgttggtaaaatgttttacaaggcatctcataatttgggtaacgctcct
gcagatttgaatgccaccgtggtaaaacattttgacaaaaagacatttgcattacaatgg
cctgaaaagaataaacgaggcgattacttgacaaaggatagatcaataagaagagttatg
gataattgtgataggcttgatttcttaatttcgaataaacttaaagcagattatggggat
tggttaagtattgattggaatttatcaccggagaagaattgggcattgattaaatcaaga
attttgactgagaggagaacgacgggaacaacagcgggtgatttgaataaagaaacattt
ttgttttggtactggtttattgacctttgcagaaaaatgtttgaattcgatccaactaag
agaattactgcaaaggaggctttggatcataaatggtttaatttgggtattttggatgaa
gggattaccagttttggtgaattacaatactga

DBGET integrated database retrieval system