KEGG   Zygosaccharomyces rouxii: ZYRO0B01276gHelp
Entry
ZYRO0B01276g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:zro00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(108095..109360)
Genome map
AA seq 421 aa AA seqDB search
MTGHLKPINQADKLKPTSRTRRTSSVGKIDLGDTVPGLSASSNSKEARHASKERVRRLSS
SNASEINIWQRFWLNYRELSYQHTWVTPLVIMSVVYAGYLVSGDYTPNNPLHMFVTISYQ
VGETNEYGKGIKDLCFILFYMVFFTFLREFLMDVVIRPLTLKLGVRSNHRIKRMMEQVYA
IIYYGVSGPIGLYLMYDSDLWFFETAPMYLTYPDFTNSYKYKWFYLGQASFWAQQAAVLV
LQLEKPRKDYPELVFHHIVTLLLIWSSYVFHFTKMGLFVYVTMDISDFWLSLSKTVNYLD
HPSTPTVFITFIFHWVYLRHWVNMRILWSVLTEFRTVGDFVLNFATQQYKCWISLPIVFS
LIAALQLVNLYWLFLILRILYRLLKDNVRKDERSESESDEEELAQTPTNDESNEAKKEKA
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacaggacatttgaagcctattaaccaggctgataagctgaaaccaacgtcaagaact
agacgtacctcatccgtagggaagatcgatttaggtgataccgtaccagggttatcggca
tcctcaaattctaaggaggcaagacatgcatcaaaggaaagagttagaaggttatcctcc
agtaatgcatctgaaattaatatttggcaaagattctggttaaattatagagaacttagc
tatcaacacacatgggtcacgccattagttatcatgtcagttgtctatgctggctatttg
gtttctggcgattatacaccaaacaatcccttgcacatgtttgttaccatatcttatcaa
gttggtgaaaccaatgaatacggcaaaggtattaaagatttgtgttttatcttattttac
atggtattcttcacatttttacgtgaattcctgatggatgttgttattagaccattgacg
ttaaaattgggggtcagatctaatcatagaattaagcgtatgatggagcaagtttacgcc
attatctactacggtgtctcaggtcctattggactgtaccttatgtatgactctgactta
tggtttttcgaaacggcccccatgtacctgacatacccagatttcaccaatagttataag
tacaaatggttctatttgggacaagcttcattttgggctcaacaggcagctgttttagta
ctacaactagaaaaaccaagaaaggactacccagaattggttttccatcacattgttacg
ttgcttctaatttggtcatcctatgtgttccatttcaccaagatgggtctattcgtctat
gtgactatggacatttccgatttttggttatctctttccaagactgtcaactatttggac
catccttcgacacctacagtctttatcactttcatcttccattgggtgtatttgcgccat
tgggtcaatatgagaatcttatggtcagttttgacagaattccgtactgttggtgatttc
gtgctaaactttgcaactcagcaatacaaatgttggatttctctacccattgtctttagt
ctgattgcagctttacaattggttaacttgtattggctgtttttaatcttgaggatttta
taccgcctgctgaaggacaatgttagaaaggacgaaagaagtgaaagtgaatccgatgaa
gaagaattagcacaaactccaacaaatgacgaatccaacgaggccaaaaaggagaaggct
ttatga

DBGET integrated database retrieval system