KEGG   Zygosaccharomyces rouxii: ZYRO0B02640gHelp
Entry
ZYRO0B02640g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
zro  Zygosaccharomyces rouxii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ZYRO0B02640g
Translation factors [BR:zro03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    ZYRO0B02640g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:215063..215899
Genome map
AA seq 278 aa AA seqDB search
MSWDEDVIGGSATNGDDAVLMESWEDGLDDEPVLDSWDKDEGEEKKPQASSESAKKTAAA
SNKKKNGGKKEKESSEPPKLAIDELDPKTRQELMKKAELESDLKNASDLLGELELAGEHP
RAQAAKRKEEEDLFAKLATPLTKDTPIGDHPLFQQAETKKDYQELRKSLATAITPLNEKS
SLNYSSSLAIDLIRDISKPMAIESIRQTVATLNILIKDKEKQERQARLAKVKGGTATGGA
GKKKAKAKTNLGGSFKKDQDLDIGGELDLGDFNDDDFM
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggacgaggatgttattggaggttccgctacgaacggagatgatgcagtttta
atggaatcctgggaagacggactagatgatgaaccagtgttagattcatgggacaaagat
gaaggtgaagaaaagaaaccacaggcatcctctgaaagtgccaagaagacagcagcagct
tctaacaagaagaagaatggtggtaagaaagaaaaagaaagttcagaaccccctaaacta
gccatagatgaattagacccaaaaactcgccaagagttgatgaagaaagcagagctagag
tccgatttgaagaatgcaagtgatctattgggtgaattagaattagcaggtgaacaccca
agggcccaagctgccaagagaaaggaagaagaagacctgtttgccaaactagcaactcca
ttgaccaaggacacccccattggtgaccacccattgtttcaacaggcagaaacaaagaag
gactaccaagaattgagaaagtccttggcaactgcaattacgccgttgaacgagaaatct
tcactcaactactcttcgtctttggcaatcgatttgatcagagatatctccaaaccaatg
gctatcgaatccattagacaaacggtagctaccctaaacattcttatcaaggacaaggag
aagcaagaaagacaggccagattggcaaaagttaaaggtggtaccgctaccggtggtgcc
ggtaaaaagaaagccaaggcaaagacaaacctcggtggatctttcaagaaggaccaagac
ctcgatattggtggtgaattggacttgggagacttcaacgatgacgattttatgtaa

DBGET integrated database retrieval system