KEGG   Zygosaccharomyces rouxii: ZYRO0B02882gHelp
Entry
ZYRO0B02882g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ZYRO0B02882g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:232092..234404
Genome map
AA seq 770 aa AA seqDB search
MRKGMIDRKKINGDRNGLVHHRANSKNRMLKELELTDNIYSKLASDIKDHPDDIRIKRGS
AALERDLDFWKMPETLEDANSLNPNVQFLSSNDNPSKDVDYKYGKISIRYQPLKLLNFQR
LLSDSTPVNSSDWNSERYSHDFDIYESEDLINMLDNDSTIPYRSAIAQKKDYSTTRTIPS
IKDREFFQNLLTQSSTARYFDANVFLADHDDEGDVLTTNTKPTKRRFRKNVDRKDARTNS
IEYIYLRDFEIKTWYTTPYPEEYNRNKILYVCEYCLKYMNSRYIYHRHELKCTHFRPPGN
EIYRDGKISVWEIDGRENVIYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEREDVGTGI
PKFHLVGYFSKEKLNSTDYNLSCILTLPIYQRKGYGHFLMEFSYLLSRREFKWGTPEKPL
SDLGLLSYRNYWKVKCAQVLVDLKILLQNSDFSNLQISLVEMSNLTGMIPTDVVFGLEQL
KVLVRRTKSDGKVQYAIKIDSWQRIEKICQNWNTKDYCKLDPSKLVWKPMIFGPSCGVNA
VGTMVETTTGATRNTSGINDHQEDFFKKSMSMLVNFMKDDIGDPRSMEVAARQKIIDRIN
IKHDDDNYGSNLREIGNWELCYEEPHLQVNGNTNHVKSKWNGNSKQDLRTTNQGLVEDDL
QYQSIDDASKPTGDDNGDDYSEKGEESFHSALEEEEDNDDGDVDVDEEDAEAVEDDDDDD
DDNDDDDDDEEDEEIMSTRRSHRLRHLRESQSQPIRHHLRGRATSYDKDI
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaggcatgatagatcgaaaaaagatcaatggagatagaaatggattagttcat
caccgtgcaaattctaaaaatcgtatgctaaaggaattagaacttacggataatatttat
tcaaagttagcaagtgatattaaagatcatcctgatgatattagaataaagaggggatcg
gcggccctcgaaagggatttagacttttggaagatgcccgaaactttggaagatgccaac
agtttaaatccaaacgttcaatttttatcatcgaatgataacccatcaaaggacgttgat
tataaatatgggaaaatttcgatacgttatcaaccattaaaactgctaaatttccaaaga
cttctgtcagattcaacacctgtaaattcatcagattggaactctgaacgttatagtcat
gattttgacatttacgaatcagaagatttgataaatatgttagacaacgatagtacgata
ccgtatagatctgctattgcccaaaagaaagactattctacaacaagaactatacccagt
atcaaggatcgtgaattcttccaaaatttactcactcaatcgtccacagctagatatttt
gacgccaatgtgtttttagctgatcatgacgatgaaggtgatgttctaacaacgaataca
aaacccactaaaagaagatttagaaaaaacgtggaccgaaaggatgcacgcaccaattcg
attgaatacatctatctaagagattttgaaattaaaacttggtatacaacaccttaccca
gaggagtacaacagaaataaaatactctacgtttgcgagtactgtttgaagtatatgaat
tcaagatatatctaccatagacatgaattgaaatgtacccactttagacctccaggtaat
gaaatttatcgtgatggtaaaatatcagtttgggaaatcgatggtcgtgaaaatgtaatt
tattgtcaaaatttgtgtctactggcgaaattgtttctaaactccaaaactctttactac
gatgtggagccgttcattttttacgttctaactgaaagagaagatgttggcacaggtata
cctaaatttcatttggttggttatttttccaaagaaaagttaaactccacggattacaat
ttaagttgtattctgactctaccaatatatcaacgtaaggggtatggtcatttccttatg
gagttttcatacttgttatcaagaagagagttcaaatgggggacacctgaaaaaccacta
tcagatttgggattattatcctacagaaattattggaaagttaaatgtgcacaagtactt
gtagatttaaaaatacttttgcaaaactctgatttttccaatttacaaataagtttagta
gaaatgtccaacctaactggcatgatccctacggatgtcgtatttggattagaacaattg
aaagtgctagtacgacgtacaaaaagtgatggtaaggtccaatatgctataaagatcgat
tcatggcaaagaattgaaaaaatatgccaaaattggaatacaaaagattactgtaaatta
gatccatcaaaattagtttggaaaccaatgatttttggaccatcttgcggtgtgaatgca
gtaggaactatggtagagaccactactggtgctactcgtaacacaagtggtattaacgat
catcaagaagattttttcaagaaaagtatgtcgatgttggtaaactttatgaaggatgat
atcggtgatccgagatccatggaagtggctgcacggcaaaagataatcgatagaattaat
attaagcatgacgatgataattatggtagtaatttacgggagataggcaattgggaattg
tgctatgaagaacctcatttgcaggtcaatggtaatacgaaccacgttaaatcaaaatgg
aatggtaattcaaaacaagatcttcgaacgaccaaccagggtttggttgaagatgattta
caatatcaaagcatcgatgacgcaagtaaaccgaccggagatgacaatggcgatgattac
agcgaaaagggggaagagagcttccattctgcgctagaagaggaagaagacaatgatgat
ggagatgtagatgtagatgaagaagatgcagaagctgtcgaggatgatgatgatgatgat
gatgacaacgatgatgacgatgatgatgaagaggacgaagagataatgagtacaaggcga
agccataggctgcgtcatctacgggaatctcagtcgcaacctattaggcaccatctgcgc
gggagagcaacaagctatgacaaagacatataa

DBGET integrated database retrieval system