KEGG   Zygosaccharomyces rouxii: ZYRO0B03652gHelp
Entry
ZYRO0B03652g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
zro  Zygosaccharomyces rouxii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ZYRO0B03652g
Messenger RNA biogenesis [BR:zro03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     ZYRO0B03652g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(301728..302804)
Genome map
AA seq 358 aa AA seqDB search
MAFYSTSVSTTMATDKDMANDIVIPNPAEDSISDISFSPQSDFLFSVSSWDNKVRIWDVQ
GGIPQGRAQFEHQAPVLCTKWSNDGTKVVAGGADNVVSMFDVATGQTKQLGLHDGPVKSM
SYLQFGGSNTDVLVTGSWDKTLKYWDARQAQPIGTVAMPDRVYTLDSRQMLLVVGTAERH
IAVINLGNPMAIFKTTQSPLKWQTRVVACYNEGDGYALGSVEGRCAIRYVDDEEQRKKGF
SFKCHRQTNSNRAPGQPAQSLVYAVNSIAFHPIYGTFATAGGDGSFHFWDKNQRHRLRGF
PSLQASIPVCSFNRNGAVLAYALSYDWSQGHMGNRADYPNVIRLHPTSDDEIKEKKRR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctttctatagtacatctgtatctactactatggccactgataaagacatggcaaat
gatattgtaatacctaatcctgcagaggattcaatttcagatatttcattctcaccgcaa
agtgattttttgtttagcgttagttcgtgggataataaagttcgtatttgggatgtgcaa
gggggtattccacaaggtagagctcaatttgaacatcaagcgcctgttttgtgtaccaag
tggtcgaacgatggaaccaaagtagttgcaggtggtgccgacaatgttgtatcgatgttt
gatgttgctacgggacaaactaaacagttgggattacacgatggacctgttaaatccatg
agttatttacagtttggtggtagtaatacggatgtattggtcacaggatcatgggataaa
acgttaaaatattgggatgctagacaagcacaaccaattggtacagtagcaatgccagac
agggtttacacactggatagtcgacagatgttacttgtggtgggcacagcggaaagacat
attgctgttataaatttgggcaatccaatggcaattttcaaaactacacagagtccatta
aaatggcaaacaagagttgttgcatgttataacgaaggtgatggatatgcacttggatca
gtcgaaggtagatgtgcaattagatatgtggatgatgaagaacagcgtaaaaaaggattt
tcgttcaaatgtcatcgacagacgaattctaacagagcaccaggtcagccggcacaaagt
ttagtgtatgctgttaatagtattgctttccatccaatatatggtacattcgctacagct
ggtggtgatggatcatttcatttttgggataaaaatcaaaggcatcgtttaagaggtttc
ccatcattacaggcaagtatcccagtttgttcatttaatagaaatggtgcagttttagca
tatgcattatcatacgattggagtcaaggacatatgggtaatcgtgctgattatccaaat
gtgattagattacacccaacttcagatgatgaaattaaggaaaagaaaaggaggtaa

DBGET integrated database retrieval system