KEGG   Zygosaccharomyces rouxii: ZYRO0B03828gHelp
Entry
ZYRO0B03828g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
zro  Zygosaccharomyces rouxii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ZYRO0B03828g
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    ZYRO0B03828g
   04113 Meiosis - yeast
    ZYRO0B03828g
Protein phosphatases and associated proteins [BR:zro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ZYRO0B03828g
Ubiquitin system [BR:zro04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     ZYRO0B03828g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:318153..320336
Genome map
AA seq 727 aa AA seqDB search
MFFGAAGSASSTNTNTNMASHQEDFSTDVNFLGTIIKLQECIQQAITQLNHDTAVFLSEL
LYSECAPLDKTHSYRLESVYLYSLSLFLNAEYHTALDVAQEFKNSSHAGIGYIFARCCLQ
LSSGLHDAVVALLNLLKKKTVPPSSAMNALIFLPTMATIHCLLGKLYRKLDKTQESALHF
SEALNADPYMWEAYVELCNMKATIDLKKLYSVMSRQNHFSTSSARYRARNGVFKSTPYKV
PNSSSSSSSSSSSSSVAFPQQHHHQQHQNQQQQQQHSQASMHPQNTPLAPPHTTTAKGQP
TNSLLNKANVVVSTLGFSPFTTKQPTASSVGKVNNRGKVLSTPPSKLLSTTNFKTPRNNT
NNNPTNSASKRKEQISFSGIKPESSNGILTTNLPSFSSLSSLHELMYNFARVLKASSQYD
SYRALRLMETQIPDHIKNVMPWCQARLGKLHFEIVNYEMSLKHFKQLRQMQPTRSEDIEV
FSTLLWHIHDKINLSHLSNELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDP
HFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYF
EKARSINPVNVILICCCGVALEKMSYQEKALQYYELASELQPSSSLAKFKKAHLLYVMAR
YSVALENFEELAELAPDEATVHFLLGQLYQIMGRKKDAVKEFTIAMNLDPKGNQLIIDAL
EKCHLQE
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgttttttggcgctgcaggatcagcttctagtacaaatacaaacacaaatatggcatct
catcaagaagatttcagtacagatgttaattttttgggtactatcatcaaattacaagaa
tgtatacagcaagcaattactcagttgaatcacgacactgctgtcttcctatcagaacta
ttatactcagaatgcgcacctctggacaaaactcatagctatagattggaatccgtctac
ttatattctttatcgctttttctaaatgcagaataccatactgcattggatgtggcccaa
gaattcaaaaattcgagtcatgctgggattggttacatttttgcccgctgttgtctacaa
ttatcatccggtttgcatgatgcagtagttgcacttttgaatctgttgaaaaaaaaaact
gtcccacctagtagcgctatgaatgcattgattttcctacctacaatggcaacaattcat
tgcttgctcggtaaactgtatcgcaaactagataagacccaggaaagtgctcttcatttc
tctgaagctcttaatgcagatccttacatgtgggaggcctacgtggaactgtgcaatatg
aaggcaacaatagatttaaagaaattgtacagtgtaatgagcagacaaaatcatttttct
acatcgtcagctcgttacagagcaagaaatggcgtctttaaatctactccgtataaagta
ccgaattcctcatcatcgtcatcatcttcatcgtcgtcatcatcagtggcattcccacag
caacatcaccatcaacaacatcagaaccagcagcagcaacaacagcactcacaagcttca
atgcatcctcagaatactcccttagcgcctcctcatactaccactgcaaaggggcaaccg
accaattcactactgaacaaggcaaacgtagtggtttctacactaggattttcaccgttc
accactaaacagcctactgctagttcagtaggtaaagtgaacaatagaggcaaagtactt
tcaactccaccttccaaacttttatctacaacaaactttaaaacaccaagaaataacact
aataacaatccgaccaacagtgcctccaagagaaaagaacaaatttctttctcaggtatc
aaacccgaaagttctaacggtattcttacgactaatctgccgtcattctcatcgttatcg
tcactacatgaacttatgtacaatttcgcccgtgtcttaaaggcgtcgtcacaatatgat
tcctacagagcgttaaggttaatggaaacccaaattccagatcacattaaaaatgtcatg
ccctggtgtcaagctcgattaggtaaattacacttcgaaattgtcaattatgaaatgtca
ttaaagcatttcaaacaattaaggcaaatgcaacctaccagatcagaggatattgaagtt
ttctccacattactgtggcatattcatgataaaataaacttatcacatttgtcgaatgaa
ttgcttgaaactcaaccggataaaccacaaacttggtgtagtttgggtaatctttactca
ttacaaagagatcacgatgaagcaattaggtattttgaaaaggctacagaagtggaccca
catttcgcatatgggtacactttacagggtcatgaacattcttccaatgactctattgat
atggccaagacatgttatcgaaaggctatagcgtcagatcctcaacattataatgcatat
tacgggctgggaatgtgttgtatgaagttgggacaatacgaagaagctcttctctatttc
gaaaaggcaaggagtatcaatcctgtaaatgtcatcctaatatgctgttgtggtgtagct
ttagaaaaaatgtcataccaagagaaggcgttacaatattacgaattagcatctgaatta
caaccatcttcatcgctggccaagttcaagaaggctcatctgttgtatgtgatggcaagg
tatagtgtagcattggagaatttcgaagaattagccgaactggcacctgacgaggcaacg
gttcatttcctcttgggacaattgtatcaaattatgggacgaaagaaagatgcagtcaaa
gagtttacaattgcaatgaatttagatcctaagggcaatcaattaattattgatgcccta
gaaaaatgtcacttgcaagaatga

DBGET integrated database retrieval system