KEGG   Zygosaccharomyces rouxii: ZYRO0B04906gHelp
Entry
ZYRO0B04906g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:zro00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    ZYRO0B04906g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ZYRO0B04906g
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: Other group
  TTK family
   ZYRO0B04906g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:395546..398089
Genome map
AA seq 847 aa AA seqDB search
MLPRYNSLPGSEQRQPPRNKGTWKYSLFPEHDQKKVSTKTIFTDDSDDEKISIPPKLSNF
GSALLSEKEKENINENDLFEMLPKDSVKPSSLNNEPYYNSVNHTPGNTYASIHSGDPSQS
TLFAQYRSHQQPSMTTMNSTDVQDKDGNDFENSFQKIKSMQQSMREELTSRHAERRSRRF
LNSSRKEFLGPAKRASAIFPEALDRRFSGTTNSNGTNDNNNSTDGLLQLNREESPEEKLS
LSSQVDLGDLNPVQYLKKHDLPTSELPRISRLYFEKQKPRKMELARLKQEILRESRTSSS
GNNGSGVQHIPIRRENSLSAATQPRRKLSDTSSRNIFQRGFSSPVARSVDSQRNILSDKS
SLKHNEYDSYPHSNTLLYSHRKREALANIDVNRNNNDQIYEPELKRYKYFDEHHNNNRNN
DYEPESKRYDLFEDHRNGNNNKDEKPISLERLPSEAPPVAIPIHPSVIQENEFHHREAPK
PPVVKKVEIVEPEKRTDSKGKSSNGEALTRRNATTVNDVEYEKIELLGRGGSSKVYKVKD
NNNKLYALKRVVFDEFDDSSVNGFKGEIELLNKLKDKTRVVKLFDYEMEHGVLYLIMECG
DHDLSQILNQRAGMPLDIEFVRYHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKII
DFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYTGQNDGDKYKQQNRWKVGKPSDV
WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIIFSEKTANDEAVPRSILDTMKACL
LRNPDKRLTVDEVLDSPFLKPVMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLG
KLADIRL
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgctaccaagatacaattcactccctggaagtgaacaaaggcagcctccgcgtaataaa
ggtacatggaagtacagtctattccccgagcacgatcaaaagaaggtctcaaccaaaaca
attttcacagatgattcagatgatgagaagataagcattccaccaaaattgagtaatttt
ggatcagctttattatcagaaaaggaaaaggaaaatattaatgaaaatgatcttttcgaa
atgttacctaaagatagtgtaaagccaagttctttgaacaatgaaccatattacaacagt
gttaaccatactccaggaaatacatatgcatcgatacattccggcgatccttcacaatct
acactctttgcacaatacaggagccaccagcaaccaagtatgacgactatgaactctact
gatgtacaagataaagatggcaacgattttgaaaacagtttccagaagatcaagagtatg
cagcaatcaatgagagaagaattgacatcgaggcacgcagaaagaagaagtagaagattt
ttgaatagtagtagaaaagagtttttaggcccagctaaaagagcatctgcaatctttcca
gaggctcttgatcgcagattttcgggtactacaaatagcaacggtaccaatgataacaat
aatagcaccgatgggctcttacagcttaaccgagaagaatcaccagaagagaaattgtca
ctatcatcacaggtagatcttggtgatttaaatcccgtccagtatttgaaaaaacacgat
ttacctacaagcgaactgccgagaatttcaagactttattttgaaaagcagaaaccaagg
aagatggaattagcaagattgaaacaagagattctacgtgagagtcggactagcagtagt
ggtaacaatggaagcggtgttcagcatattccaataaggcgagaaaattctctttcagcg
gctacgcaaccacgaagaaaattatcagacacatcttccaggaatattttccagaggggc
ttttcatcaccagtggcacgttcagtcgattcacagagaaatattttgtctgataaatcg
tccttgaaacacaatgagtatgattcttatccacatagtaatacccttttgtattcacat
cggaaaagagaagctcttgctaacatcgatgtaaacaggaataataatgaccaaatttac
gaaccagaacttaaacggtataaatattttgacgaacatcataataataacagaaataat
gactatgaaccagaatctaagcgctacgacctttttgaggatcaccgtaatggtaataat
aataaagacgaaaaaccaatttccttggaacgattgccatcagaggctcccccagttgca
ataccgattcacccttcagtgattcaagaaaacgaatttcatcacagagaggcaccaaaa
ccaccagtagtgaaaaaggtggaaattgtagaacctgaaaagagaacagatagtaaggga
aagagtagtaatggtgaggcattaacgagaaggaacgcaaccactgtaaatgatgtggaa
tatgaaaagatagaactattaggaagaggtggatcctccaaagtttacaaagtgaaggac
aataataataagctttatgctttgaaaagagttgtgtttgacgaatttgatgattctagt
gtaaatggatttaaaggtgagatagaactacttaataaacttaaggacaagacaagagta
gtaaagctatttgattatgaaatggaacatggtgtcctttatttgataatggaatgtggt
gatcatgacctttcccaaatcctaaatcagagggctggtatgcccctagatatcgaattt
gtgcgatatcatgcaagagagatgttaaaatgtgttaaagtggttcatgatgctggtata
gttcactcagatttgaagcctgctaactttgtgtttgtcaagggtatcttaaagatcatt
gattttggtattgccaatgcagtaccagaccatacggtaaatatctatcgtgaaacacaa
attggtacaccaaattatatggcacctgaggcgctggtcgcaatgaattatacgggacaa
aatgacggagacaaatacaaacaacaaaatcgatggaaagttgggaaaccttctgatgtc
tggtcttgcggttgtattatttatcaaatgatttatggtagaccaccttatggcgggttc
caaggtcaaaacagattattagccatcatgaatcctgaggtgaagatcattttttctgaa
aaaacggctaatgatgaagctgttccccgttccatattggacactatgaaagcttgtttg
ttaaggaacccagataaaagattgacagttgatgaagttcttgatagccctttcttaaaa
cctgtgatggtcactcctttctttattcgcgatctgattaaaaacgctgtcagatacggg
gcagatcaaaaggaagtatccaaagagaaagtggaagagctcgctgatgatgtactaggt
aaattagcagacatcagactgtaa

DBGET integrated database retrieval system