KEGG   Zygosaccharomyces rouxii: ZYRO0B05016gHelp
Entry
ZYRO0B05016g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ZYRO0B05016g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ZYRO0B05016g
Transfer RNA biogenesis [BR:zro03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ZYRO0B05016g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:406256..407326
Genome map
AA seq 356 aa AA seqDB search
MAFERELFVATQAVRKASLLTKRIQAQVISNRDSTTITKSDSSPVTLGDYAAQTIIIHAI
KSNFPDDKVVGEESAEGLSDGFVSEILNQVRENDEIFNKNYPSKTNLDLKETPLQSLQEV
KDTIDLGNYEGGPKGRFWCLDPIDGTKGFLRGEQFAVCLALVIDGVTQVGVIGCPNLSLS
AFGGDDLLGYEPFGYLFQAVRGQGASFASAAIDNDWKKIHVRSIDSSEEMVSLEGVEKGH
SSHDEQSQIKQFLHITRSLHLDSQVKYCMLALGLGDLYLRLPLSLTYQEKIWDHAAGNVL
VQEAGGIHTDAMENVPLNFASGRTLLTKGVIASSGPPGIHDRVVGASNKIISSRLV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaagagaattgtttgtagctactcaagctgtccgtaaggcttcacttttg
accaagagaattcaggctcaagttatctcgaacagagattctaccactataactaagagt
gatagttctccagtgacactaggtgactatgcagctcaaaccatcatcatccatgccatt
aaaagcaatttcccagatgacaaggtggttggtgaagagtctgctgaaggtttaagtgat
ggatttgtatctgaaatattaaatcaggttcgtgagaacgatgaaatcttcaacaagaat
tatccttccaagactaatttagatctcaaagaaactccacttcaatcattgcaggaggtg
aaggacacaattgatctcggtaattacgaaggcggacctaaaggtagattctggtgtcta
gatccaattgatggtaccaaggggtttttgagaggcgaacaatttgcagtatgtcttgcc
ctagtgatagatggggtgacccaagttggtgtcattgggtgccctaatctatctttgagt
gcatttggtggtgatgacttattaggctatgaaccatttggatacctgttccaagcggtt
cgtggtcaaggtgcttccttcgcctccgctgccattgataacgactggaagaagatccat
gtacgctccatcgattcctcagaagaaatggtttctttggaaggtgtcgagaagggccat
tcatctcacgatgaacaatcacagataaagcaatttttacacattactcgctcattacat
ttggattcccaagtcaagtactgcatgctagcattaggattgggcgatttatacctacgt
ctgccactcagtttgacttaccaggaaaagatttgggatcacgcagctggtaacgtactg
gtgcaagaagcaggtggaatccacacagatgctatggaaaacgtacctctaaattttgcc
agcggcagaactcttctaaccaaaggtgttattgcatctagtggtcccccaggaattcac
gatagggttgtcggtgcttctaacaagatcattagctcaagattggtataa

DBGET integrated database retrieval system