KEGG   Zygosaccharomyces rouxii: ZYRO0B05940gHelp
Entry
ZYRO0B05940g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:zro01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zro00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:zro00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:zro00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:480279..481418
Genome map
AA seq 379 aa AA seqDB search
MQQIKKNKNNNSSVYFSLQTTKNNIMSAAPAPVIPKTQKGVVFNESNGPLEYKEIPVPTP
KPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGEVIALGSNVKNWKVGDLA
GIKWLNGSCMSCESCEQSNESNCPDADLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEV
APVLCAGITVYKALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGLRVVGIDGGPGKEE
LFKTLGGEVFIDFQKESDIVGAVVNATNGGAHGVVNVSVSEGAISASTKYVRACGTSVLV
GMPAGAVCKSEVFDQVVRSTKIVGSYVGNRADTREALDFFARGLVHAPINVVPLSTLPEI
FEKMEKGQIIGRYVVDTSK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaatcaagaagaacaagaacaacaacagttcagtttatttctcactacaaaca
accaaaaacaacataatgtctgctgctccagctccagttatcccaaagacccaaaagggt
gttgtcttcaacgaaagcaacggtccattggaatacaaagaaattccagtcccaacccca
aagccaaatgaaatcttgattcacgtcagatactctggtgtctgtcacaccgatttgcac
gcctggaagggtgactggccattgccaactaagttgccattggtcggtggtcacgaaggt
gctggtgaagtcattgccctaggttctaacgtcaagaactggaaggtcggtgacttggcc
ggtatcaaatggttgaacggttcatgtatgtcctgtgaatcttgtgaacaatctaacgaa
tccaactgtccagatgctgacctttccggttacactcacgacggttctttccaacaatac
gctaccgctgacgccgtccaagctgctcacatcccaccaggaactgatctagctgaagtt
gctccagttctatgtgctggtatcactgtctacaaggctttgaagagtgctaacttgaag
gccggccaatgggttgccatctctggtgctgctggtggtctaggttctctagccgtccaa
ttcgccaaggctatgggtctaagagttgtcggtattgacggtggtccaggtaaggaagaa
ttgttcaagaccttgggtggtgaagttttcatcgacttccaaaaggaaagtgacattgtt
ggtgccgttgtcaacgctactaacggtggtgctcacggtgttgtcaacgtttccgtcagt
gaaggtgctatctctgcttctaccaagtacgttagagcttgtggtacttctgttcttgtc
ggtatgccagcaggtgctgtctgcaagtccgaagttttcgaccaagtcgttagatctacc
aagattgtcggttcttacgtcggtaacagagctgacaccagagaagctctagatttcttc
gctcgtggtttggtccatgctccaatcaacgtggtcccattgtccactttgccagaaatc
ttcgagaagatggaaaagggacaaatcatcggtagatacgtcgttgacacctccaaataa

DBGET integrated database retrieval system