KEGG   Zygosaccharomyces rouxii: ZYRO0B08140gHelp
Entry
ZYRO0B08140g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZYRO0B08140g
   01230 Biosynthesis of amino acids
    ZYRO0B08140g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0B08140g
   00030 Pentose phosphate pathway
    ZYRO0B08140g
   00051 Fructose and mannose metabolism
    ZYRO0B08140g
   00052 Galactose metabolism
    ZYRO0B08140g
  Energy metabolism
   00680 Methane metabolism
    ZYRO0B08140g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ZYRO0B08140g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ZYRO0B08140g
Protein phosphatases and associated proteins [BR:zro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ZYRO0B08140g
Messenger RNA biogenesis [BR:zro03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ZYRO0B08140g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:635368..638322
Genome map
AA seq 984 aa AA seqDB search
MGLAHEACYGVAFRSVVTNSVELFKETIHFYHKLGFSTVKDFDKFKHGENLLLSSGCSQD
SIREMWLEAFKLSEIDANGFRVPQQEADNKNQSQGALLKVRFVIGEAPKGVENFTTTYFS
TELDEVVKRFPKAEKVSDKLVVLTDPLGNRVGFTSFANALDTEPTSKEQFLGPSSQHEAE
LAGSKPDANAVKELKNSLARSQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVYAV
YEGYEGLLKGGKYLRQMHWEDVRGWLSEGGTLIGTARCKEFRERWGRKQAAYNLISEGID
ALIVCGGDGSLTGADLFRGEWPSLVADLVKDGTFTSEQVEPYKNLTMVGLIGSIDNDMAG
SDSTIGAFSALGRICELVDYIDATAKSHSRAFVVEVMGRHCGWLALLAGIATGADYIFIP
ERAAPRGKWQAELKEVCQRHRQKGRRNNTVIVAEGALDDELNHISADDVKNVLVELGLDA
KVTILGHVQRGGTAVAHDRLLATLQGVDAVKAVLEMTPETPSPLIGILENKIIRKPLMES
VELTKSVATDIENKNFDKAIMLRDTEFMELYDIFVSTTIKDDGSEMLPVTQRLNIGIVHV
GAPSAALNPATRAATLYCLSRGHKPFAIMNGFSGLIQTGQMRELSWNDVENWHNLGGSVI
GTNRSLADTDMGTVAYYFQKNKLDGLIILGGFEGFKSLKELRDNRERYPVFNIPMVMIPA
TISNNVPGTEYSLGVDTCLNALVKYTDEIKQSASATRRRVFVVEVQGGHSGFIASFTGLV
TGAVSVYSPEDQINLPAIKEDLELLCENFRHDKGENNNGKLLIRNEQASNIYSTQLLADI
IAESSKGNFGVRTAIPGHAQQGGMPSSKDRVIASRYAVKCVNFLEEWNERNKGNDADTKV
LRFQYDVHGEKKPTVQHEDDSAAVICVNGSKVSFKPIAELWENETNVALRKGEDIHWKEF
THIGDILSGRLRLRAEVASRSATA
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgggtttagctcacgaagcttgctacggtgtagcgttcagatccgtagtcactaacagc
gtggagttgtttaaagagacaattcatttttaccacaaactaggattttccacagtcaag
gatttcgataaatttaagcatggtgagaatctgttactttccagcggatgctctcaggat
tccattagggaaatgtggctggaagcctttaaattgagtgaaatcgatgcaaacggattc
cgtgttcctcagcaagaagcagacaacaagaaccagagtcaaggcgctctcctaaaggtc
agattcgttattggtgaggcaccaaagggtgttgagaactttaccactacatatttctct
acagaattagatgaggtcgtgaagagattccctaaggctgagaaggtttctgacaaattg
gttgttttgactgatccgttaggcaaccgtgttggtttcacctctttcgccaatgcgtta
gacaccgaaccaacttcaaaggagcaattcttgggacctagcagtcagcatgaagccgag
ctcgccggttcgaaaccagatgcgaacgccgttaaagaattgaaaaattcattagctcgt
agccagaaaaagaagaagattgcggttatgacaagtggtggtgattctcctggtatgaac
gcagcagtccgtgctgtggtacgtacaggtattcattttggttgtgacgtgtacgctgtt
tacgaaggttacgaaggtcttttgaaaggtggtaaatacttgcgtcaaatgcattgggaa
gatgtgagaggctggttaagtgaaggtggtacattgattggtaccgcacgttgtaaggag
ttcagagagcgttggggtcgtaaacaagcagcatacaatttgatctccgaaggtattgat
gcattgattgtgtgtggtggtgacggttccctaaccggtgcagacttgttcagaggtgaa
tggccatcgttagtggcagacttagtcaaggatggtactttcacttctgaacaagtggag
ccttacaagaacttgactatggtcggtttaattggttctatcgataacgatatggctggt
agtgattccaccattggtgcgttctctgccttgggtcgtatctgtgaattggtcgattac
atcgatgccactgccaagtctcactcacgtgctttcgtcgtcgaagttatgggtagacat
tgtggttggttagctctgttggctggtattgccactggtgccgattacatctttatccca
gaaagagcagctcctagaggtaaatggcaagcagaattgaaggaagtttgccaaagacat
agacaaaagggccgtagaaacaacactgtgattgttgctgaaggtgcattggatgatgag
ttgaatcacatcagtgccgacgacgttaagaacgtcttggttgagttgggtctggatgcc
aaggtgacaatcttgggacacgtgcaaagaggtggtaccgctgttgcccatgacagattg
ttggccactttgcaaggtgttgatgcagttaaggcagttctagaaatgactcctgaaact
ccatctcctttgatcggtatcttggaaaataagatcatcagaaagccactaatggaatct
gtggaattgactaaatctgttgccaccgatatcgagaacaagaatttcgataaggccatt
atgctaagagatacagaatttatggaattgtacgatatttttgtctctaccaccattaag
gatgatggttccgagatgttgccagttacacagagattgaacatcggtattgtccatgtg
ggtgcaccttctgcagctttgaatcctgctactcgtgctgctactttgtactgtttgtct
agaggtcacaaaccttttgccatcatgaacggtttctccggtttgatccaaaccggtcaa
atgcgtgaattatcatggaacgatgtggagaattggcacaacttgggtggttccgtcatt
ggtaccaacagatctctcgctgatactgacatgggtacagtggcatactacttccaaaag
aacaagttggatggtttaatcatccttggtggtttcgaaggtttcaaatctctaaaggaa
cttcgtgacaacagagaaagatatccagtctttaacatcccaatggtcatgattccagct
accatctctaacaacgttcctggtactgagtactcattaggtgtggacacttgtttgaac
gcccttgtgaaatacacagacgagattaaacagagtgcttctgccaccagaagaagagtc
tttgttgtggaagttcaaggtggtcattctggtttcattgcatctttcactggtttggtt
accggtgcagtctctgtgtactctcctgaggaccagattaaccttccagccattaaggaa
gatttagaattgttgtgtgaaaacttccgtcatgataaaggtgaaaacaacaacggtaag
ctattgatcagaaatgaacaagcttccaacatttacagcactcagttgttggctgatatt
atcgctgaatccagtaagggtaactttggtgtaagaaccgccattccaggtcatgctcaa
caaggtggtatgccatcttctaaggaccgtgttattgcttctcgttacgctgttaagtgt
gttaacttcttggaagaatggaatgagagaaataagggtaatgatgctgacacgaaggtt
ttaagattccaatacgatgttcacggtgaaaagaaaccaactgttcaacacgaagatgat
tctgctgctgtcatctgtgtgaatggatcaaaggtttccttcaagccaattgctgaactt
tgggaaaatgaaaccaatgtagcactacgtaagggtgaagacatccactggaaggagttc
actcatattggtgatattctatcgggtagattaagactaagagcggaagtggcatccagg
agtgcaactgcttag

DBGET integrated database retrieval system