KEGG   Zygosaccharomyces rouxii: ZYRO0B11044gHelp
Entry
ZYRO0B11044g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ZYRO0B11044g
Peptidases [BR:zro01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ZYRO0B11044g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(869260..871740)
Genome map
AA seq 826 aa AA seqDB search
MSAVNSHDSGEESYSMYPKTSSPPLPTQGSMHFPAYQPPVPIYAYPQMPYMYAGQAPGYP
FNLMNQNQMLYQGGGMPQQGGGMGSKKKWSNNGGSSGSGSGSTINGGLSSSKINHYHHHQ
MSPSFHPASMSNSSSVSSSGVNVQSKASGPRSEQYKFEISKLTSSNATSVEFPLYFNAAP
EEFKEAGSKRHELRLKALGLDQGKNQESNQEEITKKERTTIPVANVTTTAEPKKEEKKEE
PKQKTLSKDSPKPNATELNTSASLPAPTPTPAAAPAPAPAPAPTASKTPKLWSAVASGGI
AKSRSTATGGANSQGTNGLNSSNQPPQKKDKKYIPPTTKGVETLGSVALRMCFDPDYIDY
TLKSAGADKGLCVKSVAPRGIVNRANVCFMSSVLQVLLYCRPFINILNVVSVRNVVARAG
PIQSKLLDACLNIYKQFDKDTVELEKKNAAKNGSGNNSNVGSGSIRQSNVVSSISEAIKP
DEFYEALSTIPKFKDLKWGHQEDAEEFLTHLLDQLHEEFISSICSLGDNEILNLLQSIND
EELRIFFVRNLPRYKKAEFLKSSPGQLKDLISTYGTVSEDNDEEGDGWHEVSGSSKKGKK
TKTAAKRTVEMEPSPMSCLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISDKSVNDLE
TAFKKFSEYELLPFKSSSGYDVEAKKQTFIDRLPQVLLIQLKRFQFINNTDKDNSMVNYN
AYNGRIEKIRKKINYEHELIIPIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTAD
VYHRESDKWYRIDDVSIIELEKEDVLKGGEESGDSRTAYILMYQKI
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagtgaattctcacgacagcggtgaggagtcttattcgatgtatccaaagact
tcctcacctcctttgccaacccaaggtagtatgcatttcccagcttatcagcctccagta
cctatctatgcttatccacaaatgccctatatgtatgctggtcaagctcccgggtaccct
tttaatttgatgaatcagaatcagatgttataccaaggtggtggtatgcctcaacaaggt
ggtggaatgggttcgaaaaagaagtggagtaacaatggaggcagcagtggtagtggtagt
ggctctactattaatggtggtttgtcatcatcgaagattaaccactaccaccaccatcaa
atgagtccaagcttccatcccgcatccatgtcaaattcttcaagtgtcagttccagtggg
gtcaatgttcagagtaaggcttcaggaccaagatccgaacagtacaagtttgaaattagt
aaattgacatctagcaacgctactagcgtggaattccctctatacttcaatgccgcacct
gaggagttcaaggaggcaggatcaaagagacatgagttgagattaaaggctttgggacta
gatcaaggaaaaaatcaggagagtaatcaagaagaaataacgaagaaagaaaggactact
attcctgttgctaatgtcaccaccaccgctgaaccaaagaaggaagagaagaaggaagaa
cctaaacaaaagactttgtccaaggattcaccaaaacccaatgcaactgaattaaatact
tccgcatctttacctgctcctactccaactccggccgctgctcccgctcccgctcccgct
cccgctcctacagcatcaaagactcccaagttgtggtctgcggttgcctccggtgggatt
gccaagagtagatcaacagcaactggcggggctaacagtcaaggtaccaacggcctaaat
agttcaaatcagccacctcaaaagaaggataagaaatatataccccccactacaaagggt
gtagaaactctaggttccgtggcattgaggatgtgttttgaccctgattacatcgattac
actttgaaatctgccggtgcagataagggcctttgtgttaaatctgtggcaccccgtggt
attgtcaatagggccaatgtctgttttatgagttctgtgctacaggtactactttattgt
agaccctttatcaatattttgaatgtggtaagtgtaagaaacgtggtggcaagagctggt
cccatacaatccaagctattagacgcatgtcttaacatttataagcaatttgacaaggac
actgtcgagcttgaaaagaagaatgcagcaaagaatggaagcggtaacaatagcaatgtc
ggcagcggcagtatcagacagtctaatgtggtttcttctatttctgaagctattaagcca
gatgaattctacgaggctctatcgactattcccaagtttaaggatttgaaatgggggcac
caagaggatgccgaagagtttttaacacacctattggatcaattgcacgaggaattcatc
tcttccatctgttcgttaggcgataacgaaattctaaatctgttacaaagcattaacgat
gaagaattgaggattttctttgttagaaacctacctcgttacaaaaaggcagaatttttg
aagagctcacccggtcaattgaaagatttgatctccacttatggtactgtgagtgaggat
aatgatgaagaaggtgatggctggcatgaagttagcggttctagtaagaagggaaaaaag
acaaagactgccgctaagagaactgtagaaatggaaccttcgcccatgtcctgcctattt
ggtggtcaattccgttccgtcctggatattcctaacaacaaggaatcacaatcgatcact
ttggatccattccaaacaattcaactcgatatttctgataaatctgttaacgatttggag
actgcatttaaaaaatttagtgaatatgaactactgccattcaaatcttcatctggttat
gatgtagaggcaaagaaacaaacttttatcgacagattacctcaggtgttgttgattcag
ttgaaaagattccagtttattaacaatacggataaggataacagtatggttaattataac
gcctacaatggccgcattgaaaaaattcgtaagaagattaactatgaacatgaactaata
atacccatagaatccatttcttccgctaatgcatataaagatgaaaatagacgttaccat
ttaaccggtgtgatataccatcatggtgttagttcagacggtgggcattatactgctgat
gtttaccatagggaatctgataaatggtatagaatcgatgacgtaagcatcatagaattg
gagaaggaagatgttttgaaaggtggtgaagagagtggtgactcgagaacagcatatatt
ttgatgtatcaaaagatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system