KEGG   Zygosaccharomyces rouxii: ZYRO0B13420gHelp
Entry
ZYRO0B13420g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
zro  Zygosaccharomyces rouxii
Brite
Protein phosphatases and associated proteins [BR:zro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     ZYRO0B13420g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 8202689
NCBI-ProteinID: XP_002495525
UniProt: C5DS31
Position
B:complement(join(1089862..1090337,1090409..1090460))
Genome map
AA seq 175 aa AA seqDB search
MGAAPSKVIDNLLEDTNFDRDEIERLRKRFMKLDRDSSGSIDKDEFMMIPGVSANPLASR
IMEVFDADNSGGVDFQEFISGLSIFSGRGGKDEKLKFAFKIYDIDKDGYISNGELFIVLK
VMVGNNLDDEQLQQIVDRTVMENDIDGDGLLSFEEFKSAIETTEVAKSLTLQYDI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagcaccttcaaaagtgattgataaccttctggaagatactaacttcgacaga
gatgagattgaaagattgaggaagcggtttatgaaactggatagggacagttcgggatcg
attgataaggatgaattcatgatgattcccggtgtttccgctaacccacttgcgagtcgg
ataatggaagtgtttgatgcagataacagtgggggtgtcgatttccaagaatttatttca
ggtctatctatcttcagtggacgtggtggtaaagatgagaagttgaagtttgccttcaaa
atctacgatatcgataaagatggttacatctctaatggtgaacttttcatcgttttaaag
gttatggttggtaacaatttagacgatgaacagttgcaacaaattgtagatagaactgtc
atggagaatgatattgacggtgatggtctcttgtcgtttgaagagtttaagagcgccatc
gaaactaccgaagtcgctaagagtttgacattacagtacgacatatag

DBGET integrated database retrieval system