KEGG   Zygosaccharomyces rouxii: ZYRO0B14080gHelp
Entry
ZYRO0B14080g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ZYRO0B14080g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ZYRO0B14080g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:1144114..1149051
Genome map
AA seq 1645 aa AA seqDB search
MNIGNHTRIQPLRGSTTVPSFVPNRQSSSERQSVANQHGGGGASPTSQGWFFDNILNATW
VISYFLIGSTRYFTRWSFYVITVCLLRLPKWFFLSTNQFHLTISFPTFLILSMITTYLIY
CLMKEQVLSQYKTLSSDDLDSDDGETIHKSSSVTSIKDEKPEKFNPRDQLRYGKHDKDEE
SLASSYLDQFLSAIRIFGYLEKPVFHDLTKNMKTQKLDEGEILLLDNSVGFSIVVEGTLQ
IYHKVEQEKEFVDSNDNYATRENDTESLSGEDHEFTAESDADLADSEADENSLNFIELKN
GLGKFQLLNSVKQGNPVSSLVNILNLFTSANKAGDLWGGKTSNDDNNKAIHFNSPFKYEN
NWINHESRNSSTSTTPPPGLNKGHTSDDEAELMRTYSETDSMPQNLMPKVIACASTDCTI
AIIPPQAFAKLTAKYPRSASHIIQMILTRLYRVTFQTAHDYLGLTREIMDMEVLLNNSVS
YEIPFYLKETVIRKLKNERKRDDFASKTRIEDQKKDKKAQNIDATNANAQREKVTHLKPH
PSHYNPANTNLRGSRHVVLDSRDHLNPGDLLSSVPLLRKESMNPASSATQDSVSIAAPSP
PDSIPSSQIGPSSNSSKSSSKIIQKPCHSSTVLTDSGSHRHSRHEPGSSHSNLNVDVDDD
IKNRSFSAVEEETEESAVKMALVEAMFAYLGISKDNMRLPSVATSNNVSDDFGGLHKSSG
LTPNTSSSLSLSSYAAASNSGGGGTSYTSVLRILPSDYAKTSKKTKPRKKSEYKEEISPK
LTFESAKDEFAQGIQLLYFRQGTTIVEQNRKGKGLFYVMSGKIAVTTGQKDSQNAAGQQI
LDSEQHETVLYTVCAGGIAGYLSSLIGYKSFVNLKAKTDCYVGFLPSQVLERLCDKYFMM
YLRITETLTSLLSPRLLKLDHALEWIHLSASDTLFNQGDPANGIYVILSGRLRQLQKTVP
NPKGDETVSRSLDNEDLEVLGELAQGESFGEVEVLTAMNRFSTILAVRDSELARIPRSLF
ELLALEYPSIMIRVSRLVARKILATQKSGSNPPPKLVGGSGGKYDFNATIPPTKATLGQR
KHIHNSSTGSITFRTIAILPITSGLPVEAFAMKLVQAFKRVGRSTIGLNQRTALSHLGRH
AFDRLAKLKQSGYFAELEDMFQTVVYIADTPVNSSWTKTCIAQGDCILLLADATAFPEIG
EYEKLLLKTRTTARTELILLHPERYVEPGLTHRWLRHRTWIDSQHHVQFAVNPLDTESAT
KGEGLNVGALGLVDKFIQTEFSKRTQENISKLVPNSIKAHVENLSSRFMNRKRQIYTPVY
SHKNDFLRLARILSGKAIGLVLGGGGARGISHLGFLKAIEDQGIPIDMIGGTSIGAFVGG
LYAKDYDLVPIYGRVKKFAGRISSIWRMATDLTWPVTSYTTGHEFNRGIWKTFGDVRIED
FWVQYYCNSTNITESVQEIHSSGYAWRYVRASMSLAGLLPPLEDKGSMLLDGGYLDNLPV
WEMKARGCDTIFAVDVGSVDDRTPMQYGDSLNGFWIVINRWNPFSSHPNIPNMAEIQMRL
GYVASVNALEKAKQTSGVIYVRPPIEDYATLDFNKFEEIYDVGADYGHSFLSELSAQGKM
PDIPGSQSNQEGDSPEYFLRRRNSI
NT seq 4938 nt NT seq  +upstreamnt  +downstreamnt
atgaatattggaaaccacacaagaatacaaccgctacgcggatcgacaaccgtaccaagt
tttgtccctaatagacagagttcatctgaaagacaatcggttgcaaatcaacatggtggt
ggaggtgcatcaccaacatcacagggttggttttttgataatattttgaatgcaacttgg
gtaataagttattttctaattggatcgaccagatattttaccagatggtctttttatgtg
attacggtttgtctcttaagattgcccaaatggttctttctttccacaaatcagttccac
ttgaccatttctttcccaaccttcttgattttgtcaatgatcactacttatctgatctac
tgtttgatgaaagaacaggtcttgtcgcaatacaagactttatcatcagatgatttagat
tcagatgatggagagacaattcacaagtcatcgagtgttactagtattaaagatgaaaaa
cctgaaaaatttaaccctagggatcagttacgctatggtaaacatgataaggatgaagaa
tcacttgcctcgtcatatttggatcaatttttaagtgcgattagaatatttggatacttg
gaaaagcctgtgttccatgatttgactaaaaacatgaagactcaaaaactagatgagggt
gaaatacttttattggataattctgttggattttccattgttgtagaaggaaccttacag
atttatcataaagtggaacaagaaaaggaatttgtcgattctaacgataattacgcaacg
agagaaaatgatactgaatctttgtcaggtgaagaccacgagtttaccgccgagtctgac
gcagatttagctgacagtgaagctgatgaaaattctttgaattttatcgaattgaaaaat
ggacttggtaaatttcaattgcttaatagcgttaaacaggggaacccagtatcctcccta
gtgaacattttgaaccttttcacgtctgctaataaggcgggtgatttatggggtggtaaa
actagtaatgacgacaataacaaggcaatccattttaattcaccatttaaatatgaaaat
aattggatcaaccatgaatcaagaaattcaagtacatcaactacaccgccccctggtttg
aacaaaggtcatacttctgatgatgaagctgagttaatgcgaacttattccgagactgat
tctatgccacagaaccttatgcctaaagtaattgcatgtgcatctaccgactgtaccatt
gccattatcccaccacaggcatttgcaaaattaactgctaaatatccacgctctgcgtct
catatcattcaaatgattttgactagactttacagagtcactttccagacggctcacgat
tacttggggctaacaagagaaattatggatatggaagttttgttaaacaattctgtcagc
tatgaaataccattttatttgaaagaaactgtgattaggaagttaaagaatgagaggaaa
agagacgactttgcttctaaaacacgtatagaagatcaaaagaaggataaaaaggctcaa
aatatagatgcgacaaatgctaatgctcagagagaaaaggtaacacatttgaaacctcat
ccatctcattacaatcccgcaaatacaaatctgagaggttctagacatgttgtgttagat
tctagagatcatttgaatcctggtgacttattatccagtgttccgctgttgagaaaggaa
tccatgaatccagcctcttcagctactcaggattctgtttctattgccgctccttcacct
cccgattctatcccttcatctcaaataggaccttcttcaaactcttctaaatcttcttcg
aagattattcaaaaaccatgtcattcttcgactgttttgacggattctggttcccatcgt
cattctagacatgagccaggttcatctcactctaatttaaacgtcgatgtggatgatgac
atcaagaatagatctttctctgcagttgaagaggaaactgaagaatccgcagttaagatg
gcgcttgtggaagctatgttcgcctatttgggtataagtaaggataacatgagattacct
tcagtagccacttccaacaatgtaagtgatgattttggtggattgcataaatcaagtggt
ttgactccaaatacttcatccagtctttcactatcatcctatgctgcagcttctaattcc
ggtggtggtggtacttcatatacatcagtcctcagaattttacccagtgattatgcaaag
acttctaaaaagactaaacctagaaaaaaatcagagtataaggaagaaatttcacctaaa
ttgactttcgaatctgctaaggatgaattcgcacaaggtattcaattattatattttagg
caaggtactaccattgtagaacagaatcgtaagggtaaaggattgttctacgtcatgtcc
ggtaaaatagctgtcactactggtcaaaaggattcacaaaatgctgctggtcaacaaatt
ttggattcggaacaacatgagaccgttttatatacggtttgtgctggtggtattgcaggt
tatctatcttccttaatcggctacaaatcctttgtcaatttgaaggcaaagaccgattgt
tatgttggatttttgccaagtcaagtcttggaaagattatgtgataagtatttcatgatg
tacttgagaatcacggagactttaacgagtcttctttccccacgtttgttgaaattggat
cacgccttagaatggatccatctatctgcatctgatactttatttaaccaaggtgatcca
gcaaatggaatctacgtgattttgagcggtagattaagacagttacaaaagactgtccct
aatcctaagggggatgagactgtttcaaggagtttagataatgaagatttagaagtgttg
ggtgaattggcccaaggtgaaagttttggtgaagtggaagtgctaaccgcaatgaatcgt
ttcagtacaattctcgctgttagagattcagagttggcgagaatcccgagaagtttgttt
gaacttttggctttagaatacccatctattatgattcgtgtctcaagattagtggcaaga
aagatcttggcaactcaaaaatcaggttctaatccaccacctaaattggttggtggcagt
ggcggtaaatacgacttcaatgcgacgattccacctacaaaggcaacccttggtcaaaga
aaacacattcacaacagttctacaggttctatcacctttagaacgattgctattttgcct
atcacttctggtttgcctgtagaagcatttgccatgaaattggtgcaagcatttaagaga
gtgggacgttccactataggattaaatcaacgtaccgctctgtctcacttgggtcgccat
gcattcgatagattggctaaattaaagcaaagtggatatttcgctgaattggaagatatg
ttccaaactgttgtttatatcgctgatactcccgtgaattctagttggactaagacttgt
attgctcaaggtgactgtatccttttgcttgctgatgctacagcatttcctgagattggg
gaatatgaaaagctgttattgaaaacgagaactactgccagaactgaacttatcctattg
catcctgaaagatacgtggaacctggtttaactcataggtggttgaggcatagaacctgg
attgattctcagcatcatgtccaatttgctgtgaatccactggatacggaatctgccacc
aaaggtgaaggattaaacgttggtgcacttggtcttgtggataaattcattcaaactgaa
ttcagtaaaaggactcaggaaaatatttcaaaattggttcctaattccatcaaggctcat
gttgagaacctctcgtctcgctttatgaacaggaagcgtcaaatttacactcctgtgtac
tctcacaagaatgatttcttaagactggcaagaattctttcaggtaaagcgattggactt
gtccttggtggtggcggtgctagaggtattagccatcttggatttttaaaagcaattgaa
gatcaaggtataccaattgacatgatcggtggtacctcgattggtgcatttgtcggtggt
ctatatgccaaggattacgatctggttcccatttatggacgtgtgaaaaaattcgctggt
agaatatcatccatttggagaatggctactgatttaacttggcctgttacatcttatacg
actggtcacgaatttaatcgtggtatatggaaaacatttggtgacgtgagaattgaggat
ttttgggttcaatattattgtaattcgacaaacattacagaatctgtacaagagatacat
tcatctggttatgcatggagatacgttagagcatcgatgtcattagctgggttattacca
ccattggaagacaaagggtcgatgttattagatggtggttatttagataacttgcctgtg
tgggagatgaaagctcgtggttgtgatacaatttttgccgttgatgttggttcagtcgat
gatagaactcctatgcaatacggtgattcattaaacgggttctggatcgtaattaatcgt
tggaatccattttcatctcatccaaacatcccaaatatggcagaaattcaaatgagattg
gggtatgttgcatctgtcaatgcattggagaaggcaaaacaaacttcaggtgttatttat
gtcagaccaccaattgaagattatgcgactttagattttaataaatttgaggagatttac
gacgtcggagctgactatggccactcgttcctcagtgaattaagtgcacaaggtaaaatg
cctgatattccgggttctcaatccaatcaggaaggtgattctccagaatatttcctacgc
agaagaaacagcatttaa

DBGET integrated database retrieval system