KEGG   Zygosaccharomyces rouxii: ZYRO0B16280gHelp
Entry
ZYRO0B16280g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZYRO0B16280g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ZYRO0B16280g
   00630 Glyoxylate and dicarboxylate metabolism
    ZYRO0B16280g
Enzymes [BR:zro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ZYRO0B16280g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(1320302..1321963)
Genome map
AA seq 553 aa AA seqDB search
MVKVSLDNVELKVNIDAEPQFSPSTTTVANILTKDALEFVVLLHRTFNAKRKELLGARQE
VQKKLDTGNYKLDFLPETKAIREDPTWQGPTLGPGLENRSTEITGPPQRNMLVNALNAQV
NTYMTDFEDSSSPTWFNMIYGQVNLYDALRNQLNFTTPKKEYKLKSSISELPAIIVRPRG
WHMVEKHLYVDGEPISASIFDFGLYFFHNAKQAMKVNRGPYFYLPKMEHHLEAKLWNDIF
NVAQDWVGIPRGTIRATVLIETLPAAYQMEEILWQLRSHSAGLNCGRWDYIFSTVKRLRN
LPEHVLPDRDLVTMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIPNDPVANEKAMAK
VRNDKIRELTNGHDGSWVAHPALASICNEVFINMGTKNQIHYIPETTVTAQQLSDTQIPG
GQVTKRGIIQNLDIGLQYMEAWLRGSGCSPINHLMEDAATAEVSRAQLYQWVKHGVVLGD
TGEKVTPQMTSQLLKEQAAKLAAESPFGNGNKFDVAAKHFLPEVTGERFSEFLTTLLYDE
VVTQQTSTDLSKL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagtcagtttggataacgttgaattaaaggtcaatattgatgctgaaccacaa
ttcagcccttctaccactacagtggcaaatattttgactaaggatgcattggaatttgtc
gtattgcttcacagaacttttaatgcaaagagaaaggaattgttgggagctagacaagaa
gttcagaagaagttggatactggtaattacaaattagatttcttgccagagaccaaggca
attagagaagaccccacctggcaaggtcctacattaggacctggtctagaaaatagatct
accgagattactggtccaccacaaagaaatatgcttgttaatgcattgaacgctcaagtt
aacacttatatgacagattttgaagattcttcttcccctacatggtttaacatgatttat
ggtcaagttaacctgtatgatgcattgagaaatcagttgaattttacgacaccaaaaaaa
gagtacaaattaaagtcctccatttctgagttaccagcaattattgtacgcccaagaggt
tggcacatggtagaaaagcacctctatgtagatggtgaaccgattagtgcatcaattttt
gattttggtttgtacttcttccacaatgcaaagcaagctatgaaagtcaacagaggcccc
tacttctatttgcccaagatggagcaccatttggaagccaaattatggaacgatatcttc
aatgttgcccaagattgggttggtatccccagaggtaccattagggccacggtcttgatt
gaaactttaccagcagcataccaaatggaagaaattctttggcaactgcgttctcattct
gcagggttgaactgtggtcgctgggattatatcttttccactgttaagagattgcgtaat
ttacctgagcacgttctacctgacagagatctagttacaatgacttcgccatttatggac
gcttatgttaagagattgattaatacttgtcacagaagaggtgttcatgcaatgggtggt
atggccgctcaaattccaatccctaacgaccctgttgctaatgaaaaggcaatggcaaag
gttcgtaatgataagatcagagaattgacaaatggtcatgatggatcttgggttgcacat
cctgcattagcctctatctgtaatgaagttttcatcaacatggggactaaaaatcaaatt
cactatattccagaaactactgttacagcccaacagttaagcgatacccagattccaggt
ggtcaagtcactaaacgtggtattattcaaaatttggatattggtctacagtacatggaa
gcttggttaagaggttctggttgttcaccaattaaccatttgatggaagatgccgccacc
gccgaagtctctcgtgctcaattgtatcaatgggtaaagcacggtgttgtactaggtgat
actggtgaaaaggttactcctcaaatgacttcacaactattgaaagaacaggctgctaag
ttggccgcagagagtccattcggtaatggtaacaagtttgatgtcgccgccaaacacttt
ttaccagaagttacgggtgaaagattcagtgaatttttgactacattgctgtacgatgaa
gtggttactcaacagacgtctacagatttgagtaagttgtaa

DBGET integrated database retrieval system