KEGG   Zygosaccharomyces rouxii: ZYRO0B16544gHelp
Entry
ZYRO0B16544g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.4.19.12]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ZYRO0B16544g
Peptidases [BR:zro01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ZYRO0B16544g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(1342476..1345610)
Genome map
AA seq 1044 aa AA seqDB search
MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN
RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE
VDSVLDRDFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNF
HSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKHKSKS
ELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDG
DHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKF
NYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYME
MDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSS
NKEGKEKSANAKHIEPVPWKPPALPERMRNLPPPPPPATLPITKEMPPPVPPKIQLEQQE
DKNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITG
LRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMN
GGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLL
YDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGYSSYSYSTFYILS
LAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQRH
NKQSSSSGSTASPEPRKAKKKDEEGSSLKSKTKFLLFPRKRKSSSSKSLSPFNLLNSSSS
SSNTNNNSSSNSGSKKNSFSIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNI
VLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSH
GNLSQGVNKVSSKDVYVLFYERID
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaatactacttggttcacgcccgagtactccagtgaactgttgagactggtg
gaagacatctatgaagatgatataaaaccacactacgcagtcctaaaattggaagatcta
gacgatcttatggaccatacaaggtatctgtatgaatcgttttcggatgagatgaagaac
agaaataagcaagatgcattgactgcttatattattggttgctactttttgtatttgata
attccacaatcaacccaatttcaggcaagaaataagactttccaggttcacaatgcattg
aaaaaactttacgaaaatcaagttaacatgacaaacgtgttgctcatggtcaaggacgaa
gtagattctgtccttgatagagattttagaaaattgaaagacgtggaaaggaaaagggca
ttctcatcacccgataatggattggattcggagatttctcgtttaacgttagctggaaat
ggatccactttgccgaaaatgcataagaaatgggactttattcggagtgatagtaacttc
cattctcatgatacagggaacgtaccactttggaaggcccccaatttagaacccaatgat
caattgaaactagcattagattctgccgtcccgtcctcattatctgtggacaccgtgggt
aaggaggcaccagaattgtctctttcacctttaggataccctaagcataagtcgaagtcg
gagttgaccgttgaagaaaaagaacatccacagcaggaccaccgtcatcatcacggcgtg
cagcaagaaacacatcagctaggaaaagatgatgatgagcaacatttttgggatgctaaa
gtagatagagccgtggcccataggaaggattcgtatcatagtgtttacatggatgatggt
gaccatgattttggtgaaaacaaaggggccactttccctgagagtgaagtccaagctatg
aaaagattacagaagcagagtattattacttcaccggaattattctccatcctatcaaac
aagaaggaacgtaacagattgttgctgatcgatttgagattgcaatcaaggtataaattc
aactatattttagctcctaatatggttttcatagatcccaggatgttatgggacgttaac
actaagactccagtaactgatatttcagtgttggacgaaagattaaagaattcgattttc
aataagagaggttcgtttgattttatcgtttactataccgatatgaaaacttatatggag
atggattttgattacctgtttgtgttttacaacttagtggtggcatctcaagaagtatct
ctcagatctttaccatcttatctgttaggtggatatgaaaagtggaaagcagtattgaag
aaatatctaactcaatttgggataagagttgatgactatttgtacagaccttattctagt
aataaggagggtaaggaaaaatctgctaatgctaaacatattgagccagtcccgtggaag
ccaccagctttgcctgagagaatgagaaacttgcctccaccaccacctccagcgacctta
cccattaccaaagaaatgccaccgcctgttcctcccaagattcaattagaacaacaggaa
gataaaaaccatactaggcctagaagtcgtactgtaagttcacccgcagaagtgccaaaa
aatgtagttgcgcctgaacagctaagtcagttggattcttatccaatgcgtcaaagacaa
ttcagtgtacctactattgaacgtagcaataacaaatatgtggcactttccattactggt
cttcgtaacttgggggctacctgttacattaatagtatgttacaatgtctgtttgctacc
aatatgtttcgagacctttttgaaccatccaattatgaaagatttttcaatcctgaatta
gaagatactgggaaattatcaaaatcgtttagcgtcttaatccgtaaaatgtacatgaat
ggtggttgttccgtggtacctacaagttttctcaagatctgtaattttttgagacccgat
tttaacataccggatgatcagcaagatgctcaagagtttttgatgctaacaattgatcgt
cttcatgatgaattatcaaatcaaactgaagtattgaatgcacatcctgagttacttctt
tacgatgctgagacttcgaaagtacaaaaggaagaatataaacagtggtttgagaatagt
ttgatcaacactaagttttccccgattgataaaattttccaaggtcaattagagaatgga
ttacattgtaaaaaatgtggttattcatcatattcctattccactttttacattctttca
ttagcaatccctaaaccttcgtccagttttctatcttccagtaaaggtaattgggtaaat
ttagaggattgtattaatatgtttactagtgatgaagtgatgtcacgagaaaatgcatgg
gattgtcccaaatgtggtgtaactgtccaaaaggaaaaatcagaatctaatcagcgtcat
aataaacaaagcagttcttctggctcaacagcttctccagagccaaggaaagctaaaaag
aaggatgaagaaggaagtagtttaaagagtaagaccaaatttttgctatttcctagaaag
cgtaaatcatccagttcaaagtccctttctccatttaatctattaaactcaagctctagt
agtagcaacacgaataataatagcagtagtaatagcggatcaaaaaagaattctttttcc
attagagctacgaattttgttacattaccaccggtattagtgattcatctatcaagattt
tattacgatttgacaaagaaaaatgaaaccgtaatcacatatccattaattttgaacatt
gtattgaaaaataatgaaactctcaaatatagactttatgctgtggtaaatcataatggt
aatttgataagtggacattatacttcattggtaaacaagaatcgtgatcatgatttagaa
aataatcgtcaacaatggtactattttgatgatgaagtggttaaacatgaaactagccat
ggtaatttatctcaaggtgttaacaaagtctctagtaaggatgtctacgttttgttttac
gaaagaattgattag

DBGET integrated database retrieval system