KEGG   Zygosaccharomyces rouxii: ZYRO0C00836gHelp
Entry
ZYRO0C00836g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
zro  Zygosaccharomyces rouxii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:zro03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:63978..66176
Genome map
AA seq 732 aa AA seqDB search
MATSAEEIRIEDIPVDDVDFSDLEEKYKVKDDFNFDQYVVVTGAPVIPESKAPVLKKALN
GLFSKAGKVVEIEFPIDESTKKTKGFLFVECASPADGNKIIKAFHGKRLDLKHRLFIYTM
KDVEKYNSENFNTEFEEPEIPNMVPSGDLKWWLQDQEGRDQFVLQSDDLTTVFWNSAVSK
TDAVVESRNNWSSNYVRWSPKGTYLFSYHDQGAVAWGGPNFDRLMRFYHPQVRISSVSPN
EKYLVTFSADPIKADEDIKECPFTKKSDGHQIAIWEISSGLLMTTFPVVKSPFLHWPLVK
WSFNDKYCARMVGDTLVVHDCDNGFAPMENKSLKVPGIRDFQFAPTGVELQPFRANDEPS
VLLAYWTPETNNMSCKGTVVEVPRGRVLKTVNLVQVSNVTIHWQNKSEFLCFNVERHTKS
GKTLFSNLEICKIAEKDIPGEKIEIKDCVTQFAWEPNGNRFVTIAVRDTGDDNPAIPKHV
VDFWAPESKEKSKVKNGEIKRWVLVKSIANKFSNTISWSPAGRFVVVATLVKPNVRKSDF
DFYDMDYSGEKIINDAKDASAALKDVAHPTFLSATDMVWDPSGRFLALWSSSLKHKMENG
FKIFNIAGNLIREEVIANFKNFSWRPRPEHLLTNAEKKKVRKNLREWSAQFEEQDAMEAD
SAMRDLILSQRESLKNWHEYRQATSSLLKKEFGYEAFDVLPEALDSNDYTVIEEVREEIL
EEKEEKVDQVEN
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagcgctgaagaaattagaattgaagacattcccgttgatgatgtggatttt
tccgatttagaggagaagtacaaggttaaagatgactttaactttgatcaatacgtcgtt
gttactggtgctcccgtgatcccagaatcgaaggcacctgtcttgaagaaggcattgaat
ggtttgttttctaaagccggtaaagttgttgaaatagaatttccaattgatgaatccaca
aagaagactaaaggtttcctctttgttgaatgtgcatctcctgctgatggtaataagatt
atcaaggcattccatggtaagagattggatctaaaacaccgtcttttcatctataccatg
aaggatgtggaaaaatacaattctgaaaactttaacactgaatttgaagaaccagaaatt
cctaacatggtcccatctggagatttgaaatggtggttacaagatcaagaaggtagagat
caatttgtgttgcaaagtgatgatttgactaccgtgttctggaattccgctgtttccaag
actgatgctgttgtagaatcaagaaataactggtcaagcaattacgttagatggtctcca
aagggtacttaccttttctcataccatgatcaaggtgctgttgcttggggtggtccaaac
tttgaccgtttaatgagattttaccatcctcaagtgagaatttcttctgtatcaccaaac
gagaaatacttggttactttctctgctgacccaattaaggctgatgaagacattaaagag
tgtccatttaccaagaagagcgatggtcatcaaattgcaatttgggaaatcagctcaggt
ttattaatgaccactttccctgtggtcaagagtcctttcttgcactggcctttggtcaaa
tggtcattcaatgacaagtactgtgcacgtatggtaggtgatactttggttgtccacgat
tgtgacaatggattcgctccaatggaaaacaaatctttgaaggtcccaggtattagagac
ttccaatttgcccccaccggtgtggaacttcaacctttcagagcaaatgatgaaccatct
gttcttttggcttactggactccagagactaacaacatgtcttgtaaaggtaccgtggtg
gaagttccacgtggtagagttttgaagactgtgaacttggttcaagtttccaacgttacc
atccactggcaaaataaatctgaatttttgtgcttcaacgttgaacgtcacaccaagtct
ggtaagactctgttcagcaacttggaaatctgtaagattgctgaaaaggatattcctggt
gaaaaaattgaaataaaagactgtgttacccaatttgcttgggaacctaatggaaacaga
tttgttaccattgcagttagagatactggtgatgataaccctgcaattccaaaacatgtg
gttgacttctgggctcctgaatccaaggagaaatcaaaggttaagaatggtgaaattaag
cgttgggttcttgtcaagagtattgccaacaagttttccaataccatttcatggtcgcct
gccggtagatttgttgtggttgccactttggttaagcctaacgtgagaaagtccgacttc
gatttctacgatatggattactctggtgaaaagatcatcaacgatgctaaggatgcttct
gcagccttgaaagatgttgcacacccaactttcctatctgctaccgatatggtttgggat
ccatctggtcgtttcttggccctttggtcaagttctttgaaacacaagatggaaaacggt
ttcaagattttcaacattgcaggtaacttgattcgtgaagaagtaattgcaaacttcaag
aatttctcatggagaccaagaccagaacatttgttgaccaatgctgagaagaagaaggtc
agaaagaatttgagagaatggtcagcccaattcgaagaacaagatgccatggaagctgac
agcgctatgagagatctaattttgagccaacgtgaatcattgaagaactggcacgaatac
agacaagccacttcttctctattaaagaaggagttcggttacgaagcatttgacgtttta
cctgaagctttagattctaatgactacaccgttatagaggaagttcgtgaagagattttg
gaagagaaagaggagaaagtcgatcaagtagaaaattga

DBGET integrated database retrieval system