KEGG   Zygosaccharomyces rouxii: ZYRO0C02948gHelp
Entry
ZYRO0C02948g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
zro  Zygosaccharomyces rouxii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:zro03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:zro03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:zro03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:zro03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(join(229257..230029,230173..230179))
Genome map
AA seq 259 aa AA seqDB search
MSDSRPNSGESGGPNYRTNTLTPVTIKQILEAKQQVQDGPFVIHNQELHHVSFVGVVRNI
TDKTSNVELTIEDGTAQIDVRKWSDDTSDMKMSQEGNGEKDSSQVAQQYHIGEYVKVYGA
LKEFSGKSNVQYAVIKIVDSFNDVIMHHLEVIKCFSIANGKLKQPAMEEGAQQQDGKSLF
IQEDERAANSENPKERVLAYCRVRCQGQDPNDFGVPIPQFVQALDLDEDTVKQCCDTLTE
QGFIYPTITDTTYFPLNGF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattctagacctaattctggtgagtctggaggtccaaattaccgtactaacaca
cttactccagttactataaagcaaatattggaagctaaacaacaagtacaagatggaccc
ttcgtcatacataatcaagaattacaccacgtaagctttgttggtgttgttagaaacatt
acagataagacttccaatgtggagctaacgatagaagatggtacagcccaaatcgatgtt
agaaaatggagtgacgatacgagtgatatgaaaatgagtcaagaaggtaatggtgaaaag
gatagctctcaagtggcgcaacagtatcacataggagaatatgttaaagtgtacggtgct
cttaaagagtttagtgggaagagtaacgtgcaatatgctgtgattaaaattgtagactcc
tttaacgacgttataatgcatcatttggaagtcattaaatgtttttcgattgctaatggt
aaactgaaacagcctgccatggaagaaggagctcaacaacaagatgggaaatctcttttt
attcaggaagatgaaagggctgccaattctgagaatccgaaagaaagagttttggcatat
tgtagagttcgttgtcaaggccaagatcctaatgattttggtgtaccaatcccacaattt
gtacaggctcttgatttggatgaagataccgtaaaacaatgttgtgataccttgacggaa
cagggatttatttatccaaccattactgatacaacttacttcccactaaacggattttaa

DBGET integrated database retrieval system