KEGG   Zygosaccharomyces rouxii: ZYRO0C03234gHelp
Entry
ZYRO0C03234g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
zro  Zygosaccharomyces rouxii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ZYRO0C03234g
Translation factors [BR:zro03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ZYRO0C03234g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:250590..251225
Genome map
AA seq 211 aa AA seqDB search
MSVEEVSQKVQEVQINDGATKTTVLSDQSNFEVKHPLNTKWTLWYTKPAIDKSESWSDLL
RPVTSFQTVEEFWAIVQNIPEPHGLPLKSDYHVFRNDIRPEWEDEANAKGGKWSYQVRIK
SADINELWLRTLLAVIGETIDEDDSQINGVVLNVRKGGYKFALWTKSEDKEPLCNIGARF
KQVLKIGDDEKIEFFPHSDANGKHHQPTITL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgaagaagttagtcaaaaggttcaagaagttcaaatcaacgatggtgctaca
aagacaacagtattgagcgaccagagcaactttgaagttaaacacccattgaacactaaa
tggacactttggtatacgaagccagcaatcgataagagtgaatcatggtcagacctattg
cgtcctgtaacttcattccaaactgtggaagagttctgggccattgtgcaaaatatacca
gaacctcatggactaccactgaaatctgattatcacgtctttagaaatgacattagacct
gaatgggaagatgaagccaatgctaagggtggtaagtggtcataccaagtgagaattaag
agcgcagatattaatgaattgtggttaagaaccttattagccgttattggtgaaacaatt
gatgaagatgattctcaaatcaacggtgttgtgttgaacgtgagaaagggtggttacaag
tttgctttgtggacgaaatcagaagacaaggaaccactgtgtaacattggtgcaaggttt
aagcaagtgctaaagattggtgacgatgagaaaattgaattcttccctcacagtgatgct
aatggaaaacaccaccaaccaacaatcactttgtaa

DBGET integrated database retrieval system