KEGG   Zygosaccharomyces rouxii: ZYRO0C03498gHelp
Entry
ZYRO0C03498g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:zro00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    ZYRO0C03498g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ZYRO0C03498g
Chromosome [BR:zro03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     ZYRO0C03498g
   HDAC complexes
    Sin3A-HDAC complex
     ZYRO0C03498g
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    ZYRO0C03498g
  Chromatin remodeling factors
   NuRD complex
    ZYRO0C03498g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:278064..279365
Genome map
AA seq 433 aa AA seqDB search
MVYEAKPFDPITVNPRDKKRVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK
MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYC
SISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDTGVGKGKYYAVNVPLRD
GIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVNFVKS
FGLPMMIVGGGGYTMRNVARTWCFETGLLNNVILDSELPYNDYYEYYGPDYKLDVKPSNM
FNVNNPEYLDKILESVFANLERTKYAPSVQLNNVPRDLEDPGDVEEDTEEAKDTKGGSQY
ARDQIVEPDNEFY
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtttatgaggccaagccatttgatcctattacggtgaatcctcgagacaagaaaaga
gttgcatacttctatgacgcagatgtgggtaactacaactatggtgcaggccatcccatg
aaaccccataggataaggatgacacattctttgattatgaactacgggttgtataaaaag
atggagatttacagggcaaaacctgctaccaagcaggaaatgtgccaattccatacagat
gaatatatcgatttcctatcaagagttacaccagataacttggatatgtttaaaaaggaa
agtgttaaattcaatgtaggtgatgattgtcccgtttttgatggtctctacgaatactgt
agcatatctggtggtggatctatggaaggtgctgcaagactcaatagaggcaaatgtgat
gttgcgatcaactatgcaggtggattgcatcatgccaaaaagacagaagcttctggcttc
tgttatttgaatgatatagtgttgggaataattgagcttctaaggtatcaccctcgagtc
ctctacattgatattgatgtccatcacggtgatggtgtagaagaagcattctacacaaca
gatcgtgtcatgacatgttcattccacaaatatggtgaatttttccctggtacaggtgaa
ctgagggacacaggtgttggtaaggggaagtactatgccgttaacgtcccattaagagat
ggtattgacgatgctacttataaatctgtatttgaaccggttgtatccaggattatggaa
tggtatcaaccgtctgccgttgtattacaatgtggtggtgattcactttcaggagatcgt
cttggttgtttcaacctatccatccgtggccatgcaaactgtgtaaactttgtgaaatcg
tttggattaccgatgatgattgtcggtggtggtgggtataccatgaggaatgtcgctagg
acgtggtgcttcgagactggacttctcaataatgtcatcctagattccgaattaccttac
aacgattactacgagtactacggaccagactacaagttagacgttaaaccttcgaatatg
tttaacgtaaacaatccagaatacttggacaagattctagagtcagtttttgccaatttg
gagagaactaaatacgcacccagtgttcaactgaacaacgtccccagggatttagaagac
cccggtgacgttgaagaagatacagaagaagctaaagacactaagggtggatcccagtac
gctagagaccaaatcgtggaacctgataacgaattctactaa

DBGET integrated database retrieval system