KEGG   Zygosaccharomyces rouxii: ZYRO0C07238gHelp
Entry
ZYRO0C07238g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ZYRO0C07238g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ZYRO0C07238g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:546792..548690
Genome map
AA seq 632 aa AA seqDB search
MNFIESLLVLVVAGLAAAWSPKNSYVPSTVNCPDDIVLVREANGLSDNETEWLKRRRPIA
KEALHDFVKRATKNFSDNSLVDKVFSGNDSHAPVVAIGASGGGYRAMLSGAGMISAFDNR
TRGADEHGLGGVLQGATYLAGLSGGNWLTGTLAWNNWTSVQTIVDNTTADDSIWDISHSL
VNPDGVNVFGTADHWEHIFKTVRQKHKTYNASLTDLWGRALSYDFFPSLYRGGEAYTWST
LRDAEVFENGSMPFPISVADGRYPGTSVISLNATVFEFNPFEMGSWDPSLRAFTDVKYLG
TKAVDGKPEKKGECVAGYDNVGFIMGTSSTLFNQFLLRLNTTGMPRVVKSIISHFLKDIS
KNEDDIAVYSPNPFLNTSYVSNDYTSSLVDSKDLYLVDGGEDNENIPLLPFLQKERGVDV
IFALDNSADTTEYWPDGSSLVATYERQFGKMGKDIAFPYVPDVETFVAEGLNTKPTFFGC
DAQNMSDLAFTPPLVVYVPNSRMSYNGNQSTFKLSYSDNERLNMIKNGFEATTRNNLTDD
SNFAGCVACAIMRRSQESMNATLPKECKQCFQDYCWNGHISHNGTKIQHNDDYTKSASPS
ATSSSKGGASNSYSPRSGLSLFAFMVTVAGLF
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcatcgagagtttattggtcctcgtggtagctggtttagctgccgcttggtct
cccaagaatagttacgttccttcgactgttaattgtcccgatgacattgttttagttaga
gaagccaatgggttatctgacaacgaaaccgaatggttaaagcgtagaagacctattgcc
aaggaagctttgcatgattttgttaagcgtgccaccaaaaatttcagcgacaactctttg
gttgataaagtgtttagcggcaacgacagccatgcaccagtggtcgccattggtgcatcc
ggtggtggttaccgtgctatgttgagtggtgctggtatgatttccgcttttgacaaccgt
acccgtggtgctgacgagcatggtctaggtggtgtcttgcaaggtgctacttatttggct
ggtctttctggtggtaactggttaactggtactttggcatggaacaactggactagtgtg
caaacaatcgttgataacactacggcagatgattctatctgggatatttctcactccctt
gttaatccagatggtgttaatgttttcggaactgctgaccactgggagcacatctttaag
actgtccgtcaaaagcacaagacctacaatgcctcattgactgatctgtggggccgtgcg
ctttcttacgatttcttccccagcttgtacagaggtggtgaggcttacacttggtccacc
ctgagagatgctgaggtgtttgaaaatggttctatgcctttccctatcagtgttgctgat
ggtagataccctggtaccagtgtcatcagtttgaacgctactgtgtttgagtttaacccc
ttcgagatgggatcttgggatccatctctacgtgcattcacagatgtgaagtacttgggt
accaaggctgttgacggtaaacctgaaaagaagggcgaatgcgttgctggctacgacaac
gttggtttcattatgggtacttcttctaccttgttcaaccaattcttactaagattgaac
actactggtatgcctcgtgtggtgaagagcatcatcagccatttcttgaaagacatttca
aagaatgaagatgatattgccgtttactctcctaatccattcctcaacactagttatgtc
agtaatgactacacgagtagcttggtcgacagcaaagacttgtacttggtcgatggtggt
gaagataatgaaaacatcccattgttgccattcctacaaaaagaacgtggtgtcgacgtt
atctttgccctggataactctgccgacactactgaatactggccagatggttcctctcta
gtggctacttacgaacgtcaattcggtaagatgggtaaggatattgccttcccatacgtg
cctgatgttgaaacttttgttgccgagggtttgaacactaagccaactttctttggttgt
gatgctcagaatatgagtgatttggctttcacccctccattggtggtctacgtccctaac
agtaggatgtcatacaatggtaaccaatctactttcaagttgtcctactctgacaacgag
cgtctaaacatgattaagaacggtttcgaagctaccactagaaacaatttgaccgatgac
agtaactttgctggctgtgtcgcttgcgccatcatgcgtcgttctcaagaatctatgaat
gcaactctaccaaaagaatgtaaacaatgtttccaggactactgctggaatggacatatt
tctcataacggtacaaagatccaacataacgacgactacacaaagagtgcatctcctagc
gccacctctagttcaaagggcggtgcctccaattcatattctccaagaagcggtctttcc
ctattcgcattcatggtgaccgttgcaggattgttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system