KEGG   Zygosaccharomyces rouxii: ZYRO0C10912gHelp
Entry
ZYRO0C10912g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
zro  Zygosaccharomyces rouxii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ZYRO0C10912g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(840374..845398)
Genome map
AA seq 1674 aa AA seqDB search
MRWSATDFQSLYYSIESGSFDESLFQELLTDLQNLNLNENKLKNANSRSQLEKGEFTLEN
GNTYKVNEQFMVAAINLSDELNLDELVVCELILSDPSTGDEENDDEVSLVSAGKIQYFLR
RQFILQIVAFIVNCADADSPVYKKLNSNGILASKILESFKFIHVQLADIKQFVNRAQILD
NYTALFQQNVKFKRDFLLREYDVLSQILYGLVDNKTLLKKDYILQILNVASELDANDFFI
IYYLPAILHAFHELHNFQDSEVKELHSHFIKELKNESIYAKPVKVALIFVFLAYFIGWCK
LDPTKRADLYDFPRDVDEPMTAAVELGAIEQLLVFAADTSEVEKDKSMDLFYDLRSLLER
HIPRLVPKQLLDNERELQQNNNFIVNTENTNRGNGSVSNSFQRVVLSEQTQGFFLSTFNE
ALRTTIADCAFLLTKIKDAEEDSLLSGEDLDLDDISMKADLERFFLTIYFFYSARPEFSK
VFWQDKESNAYGFIEWSAKCTDNLMRSCFYLMISSLSYGSENSLSVYHYIGGNNSVSWQI
IAQCISDYISKINNLTEKVQLRQQKQESEEVDLTAVAFEEGLNEETVVFISPLLTLVGTV
AQNVDEEVKKSLSNLFGDILFEFARLETPLIGACFKTLSELVPKLESERSKFWYSLDSFV
FKDTTVTSLPDSYRDIFSSSLTNFSEVVGFLQLFNKLISIESKEENSGHIIFGKLAFPTK
LGANYRKAGVWPYFDYIFNEVFVHSTKLHHTLNVRSIQLPILQIIEQALYSFDYSVILDS
MAAGVNLDKLVDTEDFFTYIQECPATAAFNYIFTEKVYKCLFEIGDVGVDQLSIDLEHGA
DQLELIDLSVKIINDVLTYQETYIEELAPIFMRHGRSDYFVPKDFGLHGLRSFYDAIFFN
LPSVAHFGLYVGVDDYLLASNSLRILDKISLRHSSEDTQLTVKNKLLVIFDSVDESARIK
DAFISQVERPIESLEMLTLKLEVLDFINNNLSYTGRKFTVAHLLLGFQVTNILSVGPDLS
TFIGSQTSLLNSLILLLESSLQSMSADRIDYAPMRLAAAALEIILKLCRNPLTSGVVLDY
LAERQLFERLIELDLQIDSFTSWDGRFFDTKSPEHIKDFVQSESIGSLLSFLGYRNFFLQ
YMSLVIHRLSTSGRRSQINSHVDLLTSNSIYSAKIFSFLDSLNFEDLPLDYNSIKGLRLF
ANLPLNLEKVTFKICCSGNIFDFSEIQSLMNLSERVYVKEPLVNQLVTDGTQVDGIVECA
RTESSIIRSCITSYLSRKYFMERQLAILHSWVQLVQIIVSDGELSPLTRSNFILEIFGTV
VPKINDYLEFDISFSEELVSLAVFLYDVYQKDRISIDNYQTVDNRLYTLFKVCVQGINSP
LSSFSLRSDFYVLTNNYLVRMLKDSNLAKQVLRDLKLNYEVLVEIICNDAIYSQGTNRIT
SIFLLDSLIQLGNLNKENFILDSLVRNTQLLLIIRTIKNVDALLCSPSENISIEDLLYEL
TAFKSILYLLIRIAESKNGAHALIQNKLFQVIGDCSFLQVDPDLGLELVFDEMSVKSSNL
LRVNVSLDSSLFLGKETDGISMFELLVPVFQLISAVLLSMGSSNQPVIFEVKKLLVKFRK
LSLGILKRDALKDINSKYRPSVSSSEGLKQMVKLIVMLCTLTGYHGEEKLPQVF
NT seq 5025 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtctgctacagattttcaatctctatattattccattgaatcaggaagcttt
gatgaatcattatttcaagaacttttaacagatttacaaaatttaaatcttaatgagaac
aaattgaagaatgccaatagtaggtcccaattggaaaagggagaattcacattggaaaat
gggaatacttacaaggtaaatgaacagtttatggtagcagctataaatttatccgatgaa
ttgaacctcgatgaattagtggtttgtgaattaattttatctgatccttctacaggtgat
gaagaaaatgatgatgaggtatccttagtcagtgctggtaagattcaatattttttaaga
aggcaatttattttacaaatcgttgcgtttattgttaactgtgcagatgctgatagtcca
gtttacaagaaattgaattctaatgggattctagcatctaaaattttggaatcattcaag
ttcatacatgttcaattggcagatattaaacagtttgttaatagagctcagatattggat
aactacactgcattgtttcaacaaaacgtgaaatttaaaagggatttcttactgagagaa
tacgacgttttgagtcaaatcctttatggattggtcgacaataaaacactactgaagaag
gactacattttacagatattaaatgttgcatctgaacttgatgcaaacgattttttcata
atatattacttaccagcaatactacatgcattccatgagttacacaacttccaggattcg
gaagtgaaggagctccattcgcatttcattaaggaattgaaaaatgaatccatctatgca
aaaccagtcaaagtcgcattaatctttgtgttcttagcatatttcattggatggtgtaaa
ttggatccaacaaagagagcggatctttatgattttcctagagatgttgatgaaccaatg
actgcagcagttgaattgggggctatcgaacagttgttggtctttgcagctgatacttca
gaggtggaaaaggataaaagtatggatctcttttacgacttgagatcgcttttagaaaga
cacatccccaggttagtaccgaaacaattgcttgacaatgaaagagagttgcaacagaat
aacaattttatcgttaacactgagaatacaaacaggggtaatggtagtgttagtaatagt
ttccaacgcgttgtcttgtctgaacagactcaagggtttttcctttcaacgtttaatgaa
gcactaagaacaacaattgccgattgtgcctttttgttaaccaagattaaggatgcagag
gaggattctctgttgtcgggagaagatcttgacttggacgacatatcgatgaaggcagat
ttagaaaggtttttcctgacaatatatttcttttattcggcaaggccagaattttcgaaa
gtgttttggcaagataaagaatccaacgcatatggctttatcgaatggtccgctaaatgt
accgataacctcatgaggtcatgtttctatttgatgatttcgagtctttcatatggttca
gaaaattccctgagtgtctatcattatattggcggcaacaacagtgtgtcctggcaaata
attgctcaatgtatcagtgattatatttccaagatcaataatttgacagaaaaggtacaa
ctaaggcaacaaaagcaagagtcagaagaagtcgatttgacagctgttgcattcgaagaa
ggcctcaatgaggaaaccgttgtcttcatttcaccattattgacacttgttgggacagtg
gcccaaaatgttgatgaagaggttaaaaagtcattatcaaacctctttggtgatatccta
tttgagtttgctcgactagagacaccactgattggggcttgttttaaaaccctgagcgaa
ttggttcccaaactagaatcagaaagatccaaattttggtattctttggattcatttgtc
tttaaagacacaactgtcacttctctgccagattcttacagagatattttcagttcctct
ttgacgaatttctcagaggttgttgggtttttacagcttttcaataaattaatatccatc
gaatccaaagaggaaaatagtgggcacataatatttggtaaattggcattcccaactaaa
cttggtgctaattaccgtaaggcgggggtatggccttattttgactacatcttcaatgaa
gtgtttgtacattcaactaaactgcaccatactttgaacgttaggtcaatccaacttccc
atacttcagattattgaacaggcattgtattcctttgattatagcgtaatcttagactca
atggctgctggtgttaatctcgataaattggtggatacagaggatttcttcacttatatt
caggaatgtcctgcaacggctgcgtttaactatatcttcacggagaaggtttacaagtgt
ctttttgagattggagatgtgggcgttgatcagttgtcaatcgatttggaacatggggct
gatcaactagaattaatagacctttctgttaaaatcatcaatgacgttcttacttatcaa
gaaacttatattgaggaactggcgcctatatttatgagacatggtagaagtgattatttt
gtacccaaggattttggtctacatggtctacgttctttttacgatgctatatttttcaat
ttaccatcagttgcgcattttggtctatacgtaggagtggatgattaccttctggcctcc
aattcattacggatattggataagatatctttgcgtcattccagtgaagatactcaactc
acagtgaagaacaagttgctagttattttcgattcagtcgatgaatccgctagaattaaa
gatgcttttatttctcaggtagaaaggcctattgaaagtctagagatgttgacactcaaa
ttggaagttttagacttcatcaacaacaacttatcgtacactggtcgaaagtttaccgtg
gcacatttgcttttagggttccaagttaccaatattttatcagtcggaccagatttatcg
acatttattggttcccagacttcacttttgaactctctcattttacttctagaatcttcc
ctacaatccatgagtgccgataggattgattacgctccaatgagacttgctgctgctgct
ttggagatcattttgaaactttgcaggaatcctttaacttcgggcgtggtactagactac
ctcgcagagaggcagctattcgaaagattgattgagctcgatctgcaaattgacagcttc
acctcttgggacggaagattttttgacactaaatcccctgaacatatcaaggattttgta
cagagcgagtccattggatctttgctctcttttctgggttataggaactttttcctgcaa
tatatgagtttagtgattcatcgcttgtctacgagtggccgcagatctcaaatcaattct
catgtcgatttactcacttccaactccatttattcagcgaagatattttctttcctagat
agcctgaattttgaggatttaccgcttgattacaactccataaagggattgagattattt
gctaatcttccactgaatttggaaaaagtcacattcaagatatgctgctcagggaatatt
tttgattttagtgaaattcagtctttaatgaatttgtctgagagggtttatgtgaaggaa
cctttggtcaaccagctggttactgatgggactcaggttgatggtattgtcgaatgtgct
cgaactgaatcttcgattattcgctcttgcataacaagttatttgagtcgcaagtatttc
atggaacgtcaattagctattttgcattcttgggtccaactggttcaaattattgtatcg
gatggtgagctttcacctttgactcgctcgaattttatcttggaaatcttcggtacagtg
gtccccaaaatcaatgattaccttgaatttgatatctcattttcagaagagctggtttca
ttggcggtgtttttgtatgacgtttaccagaaagatcggatttctattgataattatcag
acggtggataataggttgtacactctgttcaaagtttgtgtccagggtatcaattcgccc
ctttcatccttttctctcagatctgatttttacgttctaaccaataattaccttgttaga
atgttgaaagattccaacttggctaagcaggtattgcgagatttgaaattgaattacgaa
gttttggtggaaattatttgcaatgatgcaatttatagtcaaggaacaaacagaattact
agcattttcctattggattctctcattcagttgggtaatttgaataaggaaaacttcata
ctcgattctctggtgagaaatacacaattacttttgattattcgtaccattaaaaatgtt
gacgctttactatgttctccatctgaaaatatcagtattgaagatcttctttacgaatta
acggcattcaagagtatactttacctattgattcgtattgcagaaagcaagaatggtgca
cacgcattaatacaaaacaaattatttcaagttattggagattgctcatttttgcaagta
gatccagacttaggtttggagttagtttttgatgagatgtccgtcaagagctccaattta
ctaagagttaacgtgagtttagacagttctctatttttgggtaaagaaactgatgggatt
tctatgtttgaattactcgttcccgttttccaactgatttcggctgtgttattaagtatg
ggcagttctaatcaacctgtaatcttcgaggtgaagaaacttttggtgaagtttagaaaa
ctttctttgggtatattgaagagggacgctttgaaagatataaactccaagtatcgtcct
tcagtatcaagctctgaaggattgaagcagatggtaaaactgattgtgatgttatgtaca
ttgacaggctatcatggggaggagaagcttcctcaagtattttaa

DBGET integrated database retrieval system