KEGG   Zygosaccharomyces rouxii: ZYRO0C11748gHelp
Entry
ZYRO0C11748g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ZYRO0C11748g
Transcription machinery [BR:zro03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ZYRO0C11748g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:918429..919901
Genome map
AA seq 490 aa AA seqDB search
MVAKRKHARSRSETKLSAPETKKVKIEDDADVVDDGQQYPSEVSEATAGKKPPEGQFEIP
TEEPSEAPDKKPSEEPQQQETTHQEDEKEQEQEQEQPQQQSEQSNGNSSGVKVSDEIIED
EEKGIAKFEFDGIEYKFKERPSVIEEKEGRIEFRVVNNDNTKENLMVLTGLKNIFQKQLP
KMPKEYIARLVYDRNHLSMAVVRRPFTVVGGITYRPFEKREFAEIVFCAISSTEQVRGYG
VHLMNHLKDYVRSSTNIKHFLTYADNYAIGYFKKQGFTKEITLEKSIWMGYIKDYEGGTL
MQCSMLPRIRYLDAAKILLLQEAALRRKIRTISKSHMRRPGLAAFRDLGNIKPIDPMTIP
GLKEAGWTPEMDQLAQIPKRGPHYAAMQNVLTEMQNHAAAWPFLQPVNREEVPDYYDFIK
EPMDLSTMEMNLNNNRYDKMEEFVYDARLIFNNCRLYNGENTSYYKYANRLEKFFNTKMK
EIPEYSHLVS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtagccaaacgtaagcatgccagatctcgaagtgagacaaaattgagtgcaccggag
actaaaaaggtgaaaattgaagatgatgcagatgttgtagatgatggacaacaatatcct
tcagaagtcagtgaggctacggcaggtaaaaaaccacctgaaggacaatttgaaatccca
actgaagaaccatctgaagcaccagacaaaaagccatccgaggaaccgcaacaacaagaa
acaacccatcaagaagatgaaaaagaacaagaacaagaacaagaacaaccacagcagcag
tcggaacaatcgaatggcaatagtagcggtgttaaggtttcggatgagattatagaggat
gaggagaagggaattgcaaaatttgaattcgatggtatagaatacaaatttaaagaaaga
cctagtgttatagaggaaaaagaaggtagaatagaattcagagtggtcaataatgataat
acaaaggagaatttgatggttttaacaggtttaaagaatatttttcaaaagcaattgccc
aagatgcctaaggaatacattgcgagattggtgtatgatcggaatcatttgtctatggca
gtggttagaaggccgttcacagtggttggtggtattacttatagaccgtttgaaaaaagg
gagtttgcagagattgtattttgtgccatcagttctactgaacaagttcgtgggtacggt
gtacatctaatgaatcatttaaaggattatgtgcgatctagtactaatattaaacatttt
ttaacttatgcagacaattatgccataggatatttcaagaagcagggatttacgaaagag
ataacgttagagaaaagtatctggatgggatacatcaaagattatgaaggtggtacactt
atgcaatgttccatgttacctcgaatacgatatctggacgcagcaaaaattcttttactg
caggaggcagcactaaggagaaagataagaacaatttcgaaatctcacatgagaagaccg
ggattagctgccttcagggatttgggtaacatcaaacctattgatcccatgacgatccca
ggattgaaagaagctggttggacaccggaaatggatcaattggcccaaataccgaaaaga
ggtccacattatgccgccatgcaaaatgtactaacagaaatgcaaaatcacgctgccgcc
tggccgtttttacagcctgttaatagagaagaagtccccgattattacgattttataaag
gaacctatggatttgagtacaatggagatgaatttgaataataataggtacgacaaaatg
gaggaatttgtttatgatgcaagattgatctttaacaattgtcgcctatacaacggggag
aatacttcctactacaagtacgctaatcgactggagaaatttttcaataccaagatgaag
gaaattccagaatactctcacctcgttagttaa

DBGET integrated database retrieval system