KEGG   Zygosaccharomyces rouxii: ZYRO0C13794gHelp
Entry
ZYRO0C13794g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00330  Arginine and proline metabolism
zro00332  Carbapenem biosynthesis
zro01100  Metabolic pathways
zro01130  Biosynthesis of antibiotics
zro01230  Biosynthesis of amino acids
Module
zro_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZYRO0C13794g
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ZYRO0C13794g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ZYRO0C13794g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 8203464
NCBI-ProteinID: XP_002496239
UniProt: C5DU45
Position
C:complement(1085528..1086778)
Genome map
AA seq 416 aa AA seqDB search
MSKPYTIVIKLGSSSLVDATTKEPKLSLMSLIVETVVALRRIGHRVIIVSSGGIAVGLKT
LGLDKRPKRLPEIQAVAAVGQGRLIGRWDKLFSYFDQRIAQVLLTRNDIAEWSQYKNAKN
TLQELLNMGVIPVVNENDTLAVSEIHFGDNDSLSAITAALTGADYLFLLTDVDCLFTDNP
RTNPDAKPILVVPNMDQGLPGVSTASGTGSDVGTGGMQTKLVAAELATNAGVHTIIMNSE
SPSSIFKIVQYIQTTEGKTYEGDLMDLQIKELETLNQLSVPLHTKFIASADRQHLKNREF
WMLHGLVTKGSVIIDDGAYAALTRKEKAGLLPAGVVDVEGNFQQLECVDLKLGHRLTNGE
WNKDLPTTTVGRARCNYKATEIAKIRGMKSDRIEEVLGYSDSEYVAHRHNLAFPPH
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccatatactattgttattaagttgggttcatcatcccttgtggatgcaacc
actaaggagcccaagctttccttgatgtcattaatagtcgagactgtggtagctctaagg
aggattggtcatcgtgtcattattgtatccagtggtggtattgccgtaggtctcaagact
ttaggcctcgataaaagacccaaaaggttgcctgaaattcaagcggttgccgctgtagga
caaggtagacttattggtcgttgggataagctgttctcctattttgatcaaagaattgct
caagttctcttgaccagaaatgatatagctgagtggtctcaatataagaatgctaagaac
actttacaagaacttcttaatatgggtgttatccccgtggttaacgaaaatgatacatta
gcggtgtctgaaattcattttggtgataacgacagtttatcggcaattacggctgccctt
accggtgcagactacttattcttgcttacggatgtggattgtctatttactgataatcct
aggactaatccagatgctaaaccaatcttggtggtccccaatatggatcaaggattacct
ggtgttagtactgctagtgggacaggttctgatgtgggaactggtggaatgcagaccaaa
ttagtggcggctgaattggccactaatgctggtgtgcacacaattataatgaacagtgaa
tcaccatcaagtatttttaaaatcgtacaatacatccaaactacggagggtaaaacatat
gaaggtgacttgatggatttacaaatcaaagaattggaaactctgaatcaattaagtgtt
cctctgcacacaaaattcattgccagtgctgatagacaacatttgaaaaacagggaattc
tggatgttacatgggttagtgactaaaggctctgttataattgatgacggtgcatatgca
gcattgacacgtaaagagaaagcaggactattacccgctggtgtggtagatgtggagggg
aatttccaacagctggaatgtgtagacctgaagttaggccacaggttaaccaatggtgaa
tggaataaggacttaccaacaacgactgttggtagggccaggtgtaactacaaagctact
gaaatcgctaagattagaggtatgaagagtgaccgcatagaggaagttcttggatactca
gatagtgaatatgtggcccatagacataatttggcattcccaccacattag

DBGET integrated database retrieval system