KEGG   Zygosaccharomyces rouxii: ZYRO0C14036gHelp
Entry
ZYRO0C14036g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    ZYRO0C14036g
Enzymes [BR:zro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     ZYRO0C14036g
Glycosyltransferases [BR:zro01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   ZYRO0C14036g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:1101220..1103205
Genome map
AA seq 661 aa AA seqDB search
MSQEDLSKEKSADKEDSVFLQGPQRKYLAADTLWKHRVGSLSYWDVLLTIAIIVGYAAII
LKQKFVSFVPESLYEDESDLWEAMEYYRQGKFHLSPLGALGIQLYSLIPRCKPLIRMVSL
AFASATLGILYLGERRAGISRILSLASVSGIGYLPLFQLQASQMCVEPLQWFFLSLVFYF
WQSFTYYPQFGFRWTFHLILLSVSLGLSVSTKNLGFATWAWICALALLQFWNTIGDVKLS
TCFVAKYAIFQVLLLTIIPTTIFVTSNTLMLSHWTQDSPEFSRFMSSNFKSFLRGPIEQP
VGLNYGSVVTLRHLESLGGYLHSHNYTYETGSFEQQVTLTQEENDFDNEWIVEYKFPDED
KVMINKKIHDGDEIRLRHRTTGKLLRASQAKPPVSSEEYDMEISGTGDWSYPGDSDELWK
IRIVNGPRHSIVKPLKSIIKLQNDGHPCELISHDIRLPNWGFNQQEVLCVDEAAESRTHF
YFETAEPVIPGGEEYESFYCEKGQLRCTADLLIELWQRQFKYNYYEKNNQLISPYVPETW
PFNLLGDNLSISIWIWGAVFPVVFAIYQALKLFNWNPYGPVADATLNSLLLDKVGTECTL
GWFIHYNPFFRSPHLNLDVTLYIPALLLGQIVVAQVINALYKWNQWTLAVLVAYCAVVFY
T
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagaagatttatctaaggagaaatccgctgataaggaagattcggtcttttta
caaggtcctcaaagaaagtacttagctgctgatacactttggaagcatcgcgttggctca
ctttcgtactgggatgtcctattgaccatagcgatcattgttggttatgctgctataatt
cttaagcagaagtttgtcagttttgtcccggaaagtttatatgaagatgaatcagatctt
tgggaagccatggagtactatagacagggcaaatttcatctgtctcctttaggagctctt
ggaattcagttatactccctgatcccacgttgtaaaccattgataagaatggtctccttg
gcatttgcatctgctacattaggaatcctttatttaggtgaaagaagagccggtatttcc
cgcatcttaagtcttgcaagtgtctccggtattggatatttaccattattccaattacaa
gcttcacaaatgtgcgttgaacccttgcaatggttcttcttgtcattagtattttatttt
tggcaaagcttcacttattacccacaattcggtttccgttggactttccatttaatttta
ttgtccgtttcattgggtttaagtgtatcaaccaaaaatttggggtttgccacatgggcc
tggatctgtgcattagcattacttcaattctggaataccattggcgatgttaaattgagt
acatgcttcgttgctaaatatgcaatttttcaagtcctacttttgactattatccccacg
accatttttgttacgtcaaatacattgatgttaagtcattggactcaagattctccagaa
ttctccagatttatgtcttccaatttcaaatctttcttgaggggccccattgaacagcct
gtaggtcttaattacggttcagtagttactctacgtcatttggaatctttaggtggttac
ctacactctcataactatacatatgagacgggttcatttgagcaacaagttacattgact
caagaagaaaacgactttgataacgagtggatcgtggagtacaagttccctgacgaggat
aaggttatgattaataagaagattcacgatggtgatgaaattagactgagacatcgtacc
accggtaaattgctacgtgcatcacaagctaaaccaccagtctcttctgaagaatacgat
atggaaatatctggtactggtgattggtcatatccaggtgattctgatgaactgtggaaa
attcgtattgttaatgggcctcgtcattcaatcgtgaaaccactaaaatccatcataaaa
ctgcagaatgatggccatccttgtgaattgattagccacgatataagactgccaaactgg
ggatttaatcaacaagaagtattatgtgttgacgaagcagccgaatcaagaacccatttc
tatttcgaaacggctgaaccggtgattccaggaggtgaggaatacgaatcgttttactgc
gaaaagggccaactccgttgcacggctgatctgctaattgaactgtggcaaaggcaattt
aaatataattattatgaaaaaaataaccaacttataagcccatatgtccccgaaacatgg
ccattcaacttattaggcgataatttatcaatcagcatttggatttggggagcagtattt
cctgtggtctttgccatataccaggcgctaaaattgtttaactggaatccatacggacca
gtcgctgacgctacactaaattccctattattggacaaagttggtaccgaatgtacttta
ggttggttcatccattacaatcctttcttcagaagccctcatttgaacttggatgtgact
ttatacattccagctctgctactcggacaaattgtagtggctcaagtcattaatgctctt
tacaaatggaaccaatggactctagctgtgttggtagcttactgtgccgtggtattctat
acttga

DBGET integrated database retrieval system